KEGG   Felis catus (domestic cat): 101089428
Entry
101089428         CDS       T02385                                 
Symbol
COL1A2
Name
(RefSeq) collagen alpha-2(I) chain
  KO
K06236  collagen type I alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04611  Platelet activation
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04974  Protein digestion and absorption
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101089428 (COL1A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101089428 (COL1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101089428 (COL1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101089428 (COL1A2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101089428 (COL1A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    101089428 (COL1A2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101089428 (COL1A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101089428 (COL1A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101089428 (COL1A2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101089428 (COL1A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101089428 (COL1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101089428 (COL1A2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101089428 (COL1A2)
SSDB
Motif
Pfam: Collagen COLFI
Other DBs
NCBI-GeneID: 101089428
NCBI-ProteinID: XP_003982813
Ensembl: ENSFCAG00000030892
UniProt: M3WVN3
LinkDB
Position
A2:99442446..99478320
AA seq 1367 aa
MLSFVDTRTLLLLAVTSCLATCQSLEEATARKGPTGDRGPRGERGPPGPPGRDGDDGIPG
PPGPPGPPGPPGLGGNFAAQYDPGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGE
PGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGI
RGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGS
VGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEMGLPGVSGPVGPPGN
PGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGN
KGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGRAGVMGP
PGPRGATGPAGVRGPNGDAGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGP
IGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGV
QGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGA
AGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGPSGPSGLPGERGAAGIPGGKGEKGE
TGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGPAGPAGPAGPRGSPGERGEVGP
AGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGSAGPSGPNGPPGPAGSRGD
GGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGP
PGFAGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVSGSVGEPGPLGI
SGPPGARGPSGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGA
VGAPGPHGPVGPTGKHGNRGEPGPAGVVGPVGAVGPRGPTGPQGIRGDKGEPGDKGPRGL
PGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPMGKDGRTGHPGSVGPAGV
RGSQGSQGPAGPPGPPGPPGPPGPSGGGYDFGYEGDFYRADQPRSPPSLRPKDYEVDATL
KSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFST
GETCIRAQPENILAKNWYRNSKVKKHVWLGETINGGTQFEYNVEGVTTKEMATQLAFMRL
LANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSK
KTNEWKKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRVDVGPVCFK
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactttgttgctgcttgcagtaacttcgtgcctagca
acatgccaatctttagaagaggcaactgcaagaaagggcccaactggagatagaggacca
cgtggagaaaggggtccaccaggcccaccaggcagagatggtgacgacggtatcccaggc
cctcctggcccacctggtcctcctggcccccctggtcttggcgggaactttgcggctcag
tatgaccctggaaaaggagttggccttggccctggaccaatgggtttgatgggacctaga
gggcctcctggtgcatctggagctcctggtcctcaaggtttccaaggacctgctggtgag
cctggtgagcctggtcaaactggtcctgcgggtgctcgtggtccacctgggcctcctggc
aaggctggtgaggatggtcaccctggaaaacctggacgacctggtgagagaggagttgtt
ggaccacagggtgctcgtggtttccctgggactcctggacttcccggcttcaagggcatt
aggggacacaatggtctggatggattgaagggacagcctggtgctccaggtgtgaagggt
gaacctggtgcccctggtgaaaatggaactccaggtcaaacaggagctcgtgggcttcct
ggtgagagaggacgggtcggtgcccctggcccagctggtgcccgtggaagtgatggaagt
gtgggtcctgtgggtcctgctggtcccattgggtctgctggccctccaggcttcccaggt
gctcctggccccaagggtgaacttggaccggtcggtaatcctggtcctgctggtcccgcg
ggtccccgtggtgaaatgggtcttccaggtgtttctggccctgtcggacctcctggtaac
cctggagccaacggcctgactggtgcgaagggtgctgctggcttgcccggtgttgctggg
gcacctggcctccctggaccccgtggtattcccggccctgttggtgctgctggtgctact
ggtgccagaggactcgttggtgaacctggtccagctggttccaaaggagagagtggcaac
aagggtgagcccggctctgctggtcctcaaggtcctcctggtcccagtggtgaagaagga
aagagaggccccaatggtgaagctggatccgctggcccctctgggcctcctgggctgaga
ggaagtcctggttctcgtggtctccctggagctgatggcagagccggtgttatgggccct
cctggcccccgtggtgctactggccctgctggtgtccgaggccccaatggagatgctggt
cgccctggagagcccggcctcatgggaccccgaggttttcctggtgcccctggaaatgtt
ggcccagctggcaaagaaggtcccatgggcctccctggcattgatggccggcctggacca
attggcccagctggagcaagaggagagcctggcaacatcggattccctggccccaaaggc
cccactggtgatccaggcaaaaatggtgataaaggtcatgctggtcttgccggtgctcgg
ggtgctccaggtcctgacggaaacaatggtgctcagggaccccctggaccacaaggtgtc
caaggtggaaaaggtgaacagggtcccgctggtcctccaggcttccagggtctgcctggc
cctgcaggtacagctggtgaagttggcaaaccaggagaaaggggtctccctggtgaattt
ggtctccctggtcctgctggcccaagaggggagcgtgggccccctggtgaaagtggtgct
gctggtccttctggtcctattggaagccgaggtccttctggaccccctgggcctgatgga
aacaagggtgaacctggtgtgcttggtgctccaggcactgctggtccatctggtcccagt
ggactcccaggagagaggggtgctgccggcatacctggaggcaagggagaaaagggtgaa
actggtctcagaggtgaaattggtaacccaggcagagatggtgcccgtggtgctcctggt
gctgtaggtgcccctggtcctgctggagccactggtgaccggggtgaagctggtcctgcc
ggtcctgctggtcctgctggtcctcgtggtagccctggtgaacgtggtgaggttggtccc
gctggccccaacggatttgctggtcctgctggtgctgctggtcaacctggtgctaaagga
gagagaggaaccaaagggcccaagggtgaaaatggccccgttggtcccacgggccctgtt
ggatctgctggcccatccggtccaaatggtccccctggtcctgctggcagtcgtggtgat
ggtggccctcctggtgctactggtttccctggtgctgctggacggactggtcctcctgga
ccctctggtatcactggccctcctggtccccctggtgctgctggtaaagaaggacttcgt
gggcctcggggtgaccaaggtccagttggccgaacaggggaaacaggtgcatctggtccc
cctggctttgctggtgagaagggtccctctggagagcctggaactgctggaccccctggg
acccctggtcctcaaggtcttcttggtgctcctggtattctgggtctcccaggctctaga
ggtgaacgtggtctaccaggtgtttctggatctgtgggtgaacctggacctctcggcatc
tctggtccacctggggctcgtggtccctctggtgctgtgggcgcacctggagtcaatggt
gctcctggtgaagctggtcgcgatggcaaccctgggaatgatggtcccccaggccgcgac
ggtcaacctggacacaagggagaacgcggttaccctggcaacattggtccagttggcgct
gtgggcgcacctggtcctcatggccccgtgggtcccactggaaaacatggaaaccgtggt
gaacctggtcctgctggtgttgttggtcccgttggtgctgttggtccaagaggtcctact
ggcccacaaggtattcgaggtgataaaggagagcctggtgacaaggggcctagaggtctt
cctggcttaaagggacacaatggactgcaaggtcttcctggtcttgctggccaacatggc
gatcaaggtgctcctggctctgtgggtcctgctggtcctaggggccctgctggtccttct
ggccctatgggcaaagacggtcgcactggacatcctggttcagtcggacctgctggcgtt
cgtggctctcagggtagccaaggtcctgctggcccccctggtccccctggccctcctgga
cctcctggcccaagtggtggtggctatgattttggttacgaaggggacttctacagggct
gaccagcctcgctcaccaccttctctcagacccaaggattatgaagttgatgctactctg
aaatctctcaacaaccagattgagacccttcttactcctgaaggctctaggaagaaccca
gctcgcacatgccgtgacttgagacttagccaccccgagtggagcagtggttactactgg
attgaccctaaccaaggatgcactatggatgctatcaaagtatactgtgatttctctact
ggcgaaacctgtatccgggctcaacctgaaaacatcctagccaagaactggtacagaaat
tccaaggtcaagaagcacgtgtggttaggagaaactatcaatggtggtacccagtttgaa
tataatgttgaaggagtaaccaccaaggaaatggctactcaacttgccttcatgcgcctg
ctggccaaccatgcctctcaaaacatcacctaccactgcaagaacagcattgcatacatg
gatgaggagactggcaacctgaaaaaggctgtcattctgcaaggctccaacgatgttgaa
cttgttgccgagggcaacagcaggttcacttacactgttcttgtagacggctgctctaaa
aagacaaatgaatggaaaaagacaatcattgaatacaaaacaaataagccatcccgcctg
cctatccttgatattgcacctttggacatcggtggtgccgaccaagaaatcagggtggac
gttggcccagtctgtttcaaataa

KEGG   Felis catus (domestic cat): 101092216
Entry
101092216         CDS       T02385                                 
Symbol
COL1A1
Name
(RefSeq) collagen alpha-1(I) chain isoform X1
  KO
K06236  collagen type I alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04611  Platelet activation
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04974  Protein digestion and absorption
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101092216 (COL1A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092216 (COL1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092216 (COL1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092216 (COL1A1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101092216 (COL1A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    101092216 (COL1A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101092216 (COL1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101092216 (COL1A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101092216 (COL1A1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101092216 (COL1A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101092216 (COL1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101092216 (COL1A1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101092216 (COL1A1)
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 101092216
NCBI-ProteinID: XP_003996748
Ensembl: ENSFCAG00000004564
UniProt: M3W2F5
LinkDB
Position
E1:37421033..37436982
AA seq 1461 aa
MFSFVDLRLLLLLAATALLTHGQEEGQEEEDIPPVTCVQNGLRYYDRDVWKPEACRICVC
DNGNVLCDDVICDETKNCPGAHVPPGECCPVCPDGEASPTGQETTGVEGPKGDTGPRGPR
GPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQMSYGYDEKSTGGISVPGPMGP
SGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGE
RGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGP
RGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGARGS
EGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGP
SGPPGPKGNSGEPGAPGNKGDTGAKGEPGPTGIQGPPGPAGEEGKRGARGEPGPTGLPGP
PGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGS
PGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGP
PGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGV
PGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGA
PGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGE
AGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGP
AGPTGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGK
EGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGL
PGQRGERGFPGLPGPSGEPGKQGPSGPSGERGPPGPMGPPGLAGPPGESGREGSPGAEGS
PGRDGSPGPKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPIGPVGA
RGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGP
PGAAGSPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSGGFDFSFLPQ
PPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLK
MCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPHVAQKNWYISKNPKDKRH
VWYGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGN
LKKALLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGNWGKTVIEYKTTKTSRLPIIDVA
PLDVGAPDQEFGIDIGPACFL
NT seq 4386 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttagcggccaccgccctcctgacg
cacggccaagaggagggccaagaagaagaagacatcccaccagtcacctgcgtacagaac
ggcctcaggtactatgaccgagatgtttggaaacccgaggcctgccggatctgtgtctgc
gacaacggcaacgtgttgtgcgatgacgtgatctgcgacgaaaccaagaactgccccggc
gctcatgtccccccgggcgagtgctgccccgtctgccccgacggcgaggcgtcacctacc
ggccaagaaaccacaggagtcgagggacccaaaggagacactggcccccgaggcccaagg
ggacctgccggcccccctggccgcgacggcatccctggacagcctggacttcctggaccc
cccggccctcccggaccccccggaccccctggcctcggaggaaactttgctccccaaatg
tcttacggctacgatgagaagtcaactggaggaatctctgtgcctggccccatgggtcct
tctggtcctcgtggtctccctggtccccctggcgcacctggtccccaaggtttccaaggc
ccccctggtgagcccggcgagcctggagcttcaggtcccatgggtccccgtggtccccct
ggtccccctggcaagaacggagatgacggtgaagctggaaagcctggtcgtcctggtgag
cgtgggcctcctggacctcagggcgcccggggattgcctggaactgctggccttcctgga
atgaagggacacagaggtttcagtggtttggatggtgccaagggagacgctggtcctgct
ggtcccaagggcgagcctggtagccccggtgaaaatggagctcctggccagatgggtccc
cgtggtctgcctggtgagagaggacgccccggagcccctggccctgctggtgctcgtgga
aatgacggtgctaccggtgccgccggcccccctggtcccactggccccgctggtcctccc
ggcttccctggtgctgttggtgctaagggtgaagctggtccccaaggagcccgtggctct
gaaggtccccagggtgtgcgtggcgagcccggcccccctggccctgctggtgctgctggc
cctgctggaaaccccggtgctgacggacagcctggtgccaaaggtgccaacggcgctcct
gggattgctggcgctcctggcttccctggtgcccgaggcccctctggaccccagggcccc
agcggccctcccggtcccaagggtaacagtggcgaacctggtgcccccggcaacaaagga
gacactggcgccaagggagagcccggccccactggtatccaaggcccccctggccccgct
ggggaagaaggaaagcgaggagcccgaggcgaacccggccccactggcctgcccggaccc
cctggcgagcgcggtggacctggtagccgtggcttccctggcgcagatggtgtggctggt
cccaagggtcccgccggtgaacgtggttctcctggccctgctggccccaaaggttctcct
ggtgaagctggtcgccccggtgaagctggtctgcctggtgccaagggtctgaccggaagc
cccggcagccccggtccggatggcaaaactggtccccctggtcccgctggtcaagatggt
cgccccggacccccaggcccccccggtgcccgtggtcaggctggtgtgatgggattcccc
gggcctaaaggtgctgctggagagcctggcaaagcaggagaacgaggtgtccctgggccc
cctggcgctgttggtcctgctggcaaagatggagaagctggagctcagggaccccccggc
cctgccggccccgctggtgagagaggcgaacagggccctgctggctctcccggattccag
ggtcttcctggccccgcgggtcctcctggcgaagcaggcaaacctggcgaacagggtgtt
cctggagatcttggtgcccccggcccctctggagccagaggcgagagaggtttccctggt
gaacgcggtgtgcaaggtccccccggtcctgccggtcctcggggagccaacggtgcccct
ggcaatgatggtgctaagggtgatgctggtgcccccggagcccccggtagccagggcgct
cctggccttcagggaatgcctggtgaacgaggtgcagctggccttcctggccctaagggt
gacagaggcgatgccggtcccaaaggtgctgatggttctcctggcaaagatggtgtccgt
ggcctgactggccccattggtcctcctggccccgctggtgcccccggtgacaagggtgaa
gctggtcccagcggccccgctggtcccactggagctcgtggcgcccccggagaccgtggt
gagcctggtccccccggccctgctggcttcgctggcccccctggtgctgatggccaacct
ggtgctaaaggcgagcccggagacgctggtgctaaaggcgatgctggtccccctggtccc
gctggccccactggaccccccggccccatcggcaacgttggtgctcctggacccaaaggt
gctcgaggcagtgccggtccccctggtgctactggtttccctggtgctgctggccgagtc
ggtcctcccggcccctctggaaacgctggaccccctggccctcccggccctgtcggcaaa
gaaggcggcaaaggcccccgcggtgagactggccccgctgggcgtcccggggaagtcggt
ccccctggtccccctggccctgccggtgagaaaggatctcctggtgctgatggacctgct
ggtgctcccggcactcccggacctcaaggcattgctggacagcgtggcgtggttggcctg
cccggtcagcgaggagaaagaggcttccctggtcttcccggcccctctggtgaacctgga
aaacaaggtccttctggaccaagtggtgaacgtggcccccctggtcccatgggcccccct
ggattggctggaccccctggcgagtctggacgtgagggatctcctggtgctgaaggctcc
cctggacgagatggttctcccggccccaagggtgaccgtggtgagaccggccctgctggc
ccccctggtgctcctggcgctcctggtgcccctggtcccgtcggccccgctggcaagagt
ggcgaccgtggcgagactggtcccgctggtcccgccggtcccatcggccccgtcggtgct
cgtggtcccgctggaccccaaggcccccgtggtgacaagggtgagacaggcgaacagggt
gacagaggcataaagggtcaccgtggcttctccggtctccagggtccccctggccctccc
ggctctcctggtgaacaaggtccttccggagcttctggtcctgctggtccccgaggtccc
cccggcgctgctggctctcctgggaaggacggactcaacggtctcccaggccccatcggc
ccccctggtcctcgtggtcgcactggtgacgctggccctgttggtccccccggccctcct
ggaccccccggtcctcccggtcctcccagcggtggtttcgacttcagcttcctgccccag
ccacctcaagagaaggctcacgatggcggccgctactaccgggccgatgatgccaacgtg
gtccgtgaccgtgacctcgaggtggacaccaccctcaagagcctgagccagcagatcgag
aacatccggagccccgaaggcagccgcaagaaccctgcccgcacctgccgcgacctcaag
atgtgccactccgactggaagagcggagaatactggatcgatcccaaccaaggctgcaac
ctggatgccatcaaggtcttctgcaacatggagacaggtgagacctgcgtgtaccccact
cagccccacgtggcccagaagaactggtacatcagcaagaaccccaaggacaagaggcac
gtctggtatggcgagagcatgaccgacggattccagttcgagtatggtggccagggctcc
gatcccgccgatgtggccatccagctgacgttcctgcgcctgatgtccaccgaggcgtcc
cagaacatcacctaccactgcaagaacagcgtggcctacatggaccagcagactggcaac
ctcaagaaggccctgctcctccagggctccaacgagatcgagatccgggccgagggcaac
agccgcttcacctacagcgtcacctacgacggctgcacgagtcacaccggaaactggggc
aagacagtgatcgaatacaaaaccaccaagacctcccgcttgcccatcatcgatgtggcc
ccattggacgttggcgccccagaccaggaattcggcatcgacattggccctgcctgcttc
ctgtaa

KEGG   Felis catus (domestic cat): 105261147
Entry
105261147         CDS       T02385                                 
Name
(RefSeq) collagen alpha-1(I) chain
  KO
K06236  collagen type I alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04611  Platelet activation
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04974  Protein digestion and absorption
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    105261147
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    105261147
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105261147
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105261147
  09152 Endocrine system
   04926 Relaxin signaling pathway
    105261147
  09154 Digestive system
   04974 Protein digestion and absorption
    105261147
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    105261147
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105261147
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105261147
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    105261147
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105261147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    105261147
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   105261147
SSDB
Other DBs
NCBI-GeneID: 105261147
NCBI-ProteinID: XP_023100267
LinkDB
Position
E1:797964..802753
AA seq 1141 aa
MGGGCPPCRRAAPGPLGGSGALTAPRPPCARCYGDRASGRKRGLAGPPARSPEPLSRGRP
RRSRAPSPPLLRSSGGRGRARACVCAAAPAAGGGRGAERGGAGGPAAMSGAAGRCVGPSR
PGRGRGRPWGKRGAAGAPRGRGAGRRATTSAWDTRCVSAERLRDCRRPRGRRAEADAAGA
AGANGPEASETAGAAGSAEAAGDPGAVWVDGAVGEPQVVGPVGSVWVTGTGGEEDGAPYR
SPRGCERKGRPGSMGHESILELWLKVQAMRAAAGCGEGSRVELHPVPAGEGPVDRGVPGR
ASWVETSRGGLTGPWVKGQARAMPRTSGVSTGVGPGAGCERVPGLCGRGQAAGLLPGGVP
GMVPYLLGRGQATGWPAPVDRERGWGSAPGPWGRGQSLQVRGAPGPETVCGDTPGSWRGG
QASRVLPDAVGAPGRVEEEASCTGALGAWHNGQAVEGMGSGGAPGTWGTGQPVRVPCAVE
EEARCGGDPGFRERGQAVWVETGSGGDPGSWAAAHAAEACGPAELQVGPGGAPGLWSVEQ
GLGVPTALGRETGCGSIPGVWGTQQPVGAAVAGPGALGGQAGYGAAPGLWDGQRALGAPE
VVAGDTGCGGVVSLWDGRQALGEQETLLPAALGAPGPAGQEASPRDVSCLCRRRQAEGLP
GAAVLPRHRCGPGGFTRAPVAVPAAVWVSGSTCQDGSSRGGLSLCDGVSAALLPVAPEGP
WSAGETAASAAFPGPWERGQAIGGPEAPGLAGQETGSGGVPRPWGRRPSAGASAAAPVPV
APRTPRPVREESTPGGVAGLWGERDTVQAPVDARGPSRMGLPPSAGMPGPTGERLGPGGP
SGSLGGGQAAEMPGAEGVPTAAGAPGPMMANASCGDVSGVWGQRPVTEGPVDGPWRRRAS
GPVPEAARVPLPLGVLAAVGVPAAGRVPAVVWVTGCAGEEAAEAAAGLPVSRTPSAEGAG
ASTRRGPGPSSAGSSVLRRLPWTVVTVVTKASGTAWPPCPPVFVVALVSAAGSRCSDPEA
SPGAGRLCPAELAQGVSTLPFAEWLGFAHADCEQKAAWFPWQSRFWSNASLVALEVWAQR
VATHTVSPVLLERRIPKGKTLLWRTLAGTFLEYPLVSARLLRASSRVLSSEGGMVSPPSG
V
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgggcggcggctgcccaccctgccgccgtgcagccccgggacccctaggcggctcggga
gccctaacggctcccaggccgccctgcgcccgttgctatggcgaccgcgcgagcggccgg
aagcgcggcctagccggcccccccgcccgctccccggagcccctgagccgcggccggccc
cgccgctcgcgggccccgtcaccgccgctcctgcggagctcggggggccggggccgagcg
cgtgcgtgcgtgtgtgcggcggccccggcggcgggcggcgggcggggggccgagcggggc
ggcgcgggcgggcctgcagccatgagcggggcggcgggccgctgcgtggggcccagccgg
ccggggcgcgggcgcgggaggccgtgggggaagaggggcgccgcgggggcgccgcgcggc
cggggagcggggcgccgggcgacgacctcggcgtgggacacgcgctgcgtgagcgcagag
aggctgcgagactgtcggcggccccgggggaggagagcggaggccgacgcggccggggcg
gcgggggccaacgggccggaggcctcggagaccgccggcgccgcaggctcggcggaggcc
gcgggggacccgggcgccgtgtgggtggacggcgcggtgggggagccccaggtggtgggg
cctgtcgggtcggtgtgggtgacgggcaccggcggggaggaggacggggcgccttaccgg
agcccccggggctgtgagcggaaaggccgcccgggatccatggggcacgagagcatcctg
gagctgtggctgaaggtgcaggctatgcgggcggcggcggggtgcggggagggaagcaga
gtggagctccacccggtgcccgcgggagagggcccggttgacaggggcgtccccggcagg
gcctcctgggtggagacgagccggggtggtctcacggggccctgggtgaagggacaggct
cgggcaatgccccggacctcgggagtgtccacaggcgttgggcccggggcgggttgtgag
agggtcccaggcctgtgcgggcggggacaggcggctggcctgctgcctgggggtgtgcct
gggatggtgccctacctgctggggagaggacaggccacggggtggcccgcgcctgtggac
agggagaggggctgggggagtgcccctggtccgtggggcagagggcagtccctgcaggtg
cggggggctcctggcccagagaccgtctgtggggacaccccgggctcatggagagggggg
caggcctcgagggtgctgcctgatgctgtgggggcgcccggcagggtggaggaggaagcc
agctgtacaggtgccctgggcgcgtggcacaacggacaggccgtggaggggatggggtct
gggggtgctcctggcacgtggggcactggacagcccgtgcgggtgccttgtgctgttgaa
gaggaagctagatgtgggggtgacccaggattcagggaacgggggcaggctgtgtgggta
gagaccggctctggaggggacccgggttcctgggcagccgcacacgctgcagaggcatgc
ggtcctgccgagctgcaggtgggccctggaggcgctccaggcctgtggagtgtggagcag
ggcctgggggtgcccacggccctggggagggagacaggctgcgggagcatccctggtgtg
tgggggacccagcagccggtgggggcagcggtggcgggaccaggggccctgggaggacag
gcgggttacggggctgccccaggcctgtgggacgggcagcgggccctgggggcgccggag
gtggttgcgggggacacaggctgtgggggtgttgtgagcctgtgggacgggaggcaggct
ctgggggagcaggagaccctgctgcccgcagcgttgggggcacccgggcctgcgggtcaa
gaggccagccccagggacgtgtcttgtctgtgcagaaggagacaggcagaggggctgcct
ggggccgcagtcctgcccaggcacaggtgcggcccgggggggttcacgagggcgcctgtg
gccgtgcccgccgccgtgtgggtgtccggctccacgtgccaggatggcagctctcgaggt
ggcttgagcctgtgcgacggcgtctctgctgccctgttacccgtggctcccgaggggccg
tggtctgcgggggagactgcggcttctgcagctttcccaggcccgtgggagagggggcag
gccatcgggggtcctgaagcgcccgggcttgcggggcaggagacgggctctgggggtgtg
ccgagaccttggggacggagaccgagtgcaggggcgtctgccgctgccccggtgcccgtg
gctcccaggacgccccggccggtccgggaggagtccacccccgggggtgtcgcaggcctg
tggggggagagagacacggtacaagcacccgtagacgccaggggtccctcacggatgggg
ctgccccccagcgccgggatgcctgggcccacgggggagaggctgggcccggggggcccc
tccggctcgctgggaggggggcaggctgctgagatgcctggggccgagggggtgcccacg
gcggcgggggcccccgggccgatgatggccaatgccagctgtggggatgtctcgggcgtg
tggggacagagaccggtgacggagggacctgtggatggcccatggaggagaagagccagc
gggccggtccctgaggctgccagggtgcccctccctttgggggtgctcgcggctgtgggg
gtgcccgccgcggggcgcgtgcctgccgtggtgtgggtgactgggtgtgccggggaagaa
gccgctgaggctgccgccggcctcccagtgtccaggacgccgtctgcggagggagctggg
gcttcaactcgcaggggccccggccccagctctgcgggctcctccgttctgcggcggctg
ccctggactgtggtgaccgtggtgaccaaagccagcgggactgcctggcccccgtgccct
cccgtcttcgttgtcgctctcgtctctgcagctggatctcggtgttctgaccccgaggcc
tcacccggagccggtcggctctgccctgccgagctagcccagggagtgagcacgctgccc
ttcgccgagtggctagggtttgctcacgcagactgtgagcagaaggctgcctggttcccg
tggcagagccgtttctggagtaacgcctcactggtggcccttgaggtttgggctcaacgg
gtagccactcacacggtgtcccccgttctcttggaaaggaggattccaaaagggaagacg
cttttgtggaggaccctggccggtaccttcctggagtacccgctggtcagcgcgaggctg
ctgcgggcctcctctagagtactgtcctctgagggtggcatggtgtcccctccttccggt
gtttga

DBGET integrated database retrieval system