KEGG   Felis catus (domestic cat): 101089505
Entry
101089505         CDS       T02385                                 
Name
(RefSeq) complement factor H isoform X1
  KO
K04004  complement factor H
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101089505
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101089505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089505
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101089505
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 101089505
NCBI-ProteinID: XP_023103753
LinkDB
Position
F1:complement(46843695..46943457)
AA seq 1181 aa
MRFSAQVVWLMWWTVCVAEDCEEPPPGKQNEILVGVWPEQKYPEGTQATYKCRPGYRTLG
VIIMECKNGEWVALNPLRICQKRPCGHPGDTPFGSFHLARGNEFEYGAKVVYTCNEGYQM
LGTINFRECDPDGWTNDIPICEVVKCLPVTHPENGRLTSSALELDKEYTFGQVVRFVCNS
GFMLVGPAEIRCSTNGVWSGESPKCVEISCQKPEIANGNAASLKKTYKENERFQYTCHQG
YEYSSKGDAICTASGWTPTPSCKEIICASPHIQNGNYAPESIRYRSGDEITYNCKTGFDR
STQGNTATCTNRGWVPQPGCTRNRCDFPQIKHGSLYYEIIYRLDFPVRVGKKYWYSCKTN
FVTASQEPWEYIHCTKEGWSPEVPCRRQCIFNHLKNGDNPKQGVKYIQGESVRVNCHAGY
SLQNEQTVMTCTEGGWFPPPECILLKTCSKSEITIENGFFSQYELTYYLNKETQYQCKPG
YVTPDGKTSGSVRCLKSGWSPQPTCIKSCDMPAFENAKAKSSGTWFKLNDKLDYECHDGY
ESQDGRAGSIVCGNDGWSHKPICYEKECKIPEIENNLNTQPRKEKYKVGDVLKFFCRQRL
KRVGPDSVQCYDFGWSPNLPTCKEQTKQCSPPPQLLNGKVKETQKENYEHNDLVEYVCNP
RFLMKGVNKIQCVDGQWTDLPICIEVETTCGDIPELNYGYAVQTSNPPYHHGDSVQFNCR
EGFTMIGQKSITCISGLWTQLPQCIATDELQKCKYSLTIREANPLYKTEFDHNENITYKC
RGKLKQKHSTCINGRWDPELNCTEVQMQSCPPPPQIPNAHKMATTVNYQDGEKVSVVCQD
NYIIQDAEEIVCKDGRWQSIPHCVEKSPCPQPPQIEHGTIKSSPFSEEMDEPLKPEVYVH
GTKLNYSCEDGFRISGKDEITCHMGKWSSPPRCVGLSCAPPHLIPHGILSHVSDSYQYGE
EVTYKCTEGFEINGPAFIRCIGGKWSHPPECKNTDCFSLPDFGNATPIGQKKTLYRSGEK
VTYKCPNNYLLDGPNTIQCINSQWIGKPICRDPNENCGPPPPLDNGDMTTFPKSEYPPGS
SVEYRCQSLYVLEGNKVITCRYGQWSKPPKCLDVCIISEDSMERHNIQLRWSSVKKLYSP
TGDTVEFECKTGYRSQTSQQTFRATCWEGKLTYPVCVKSNG
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgagattttcagcacaggttgtttggcttatgtggtggactgtttgtgttgcagaagat
tgtgaagaaccgcctccaggaaaacaaaatgaaattttggtaggtgtctggcctgaacaa
aaatatccagagggaactcaggctacatataaatgccgacctggatatagaactcttgga
gttattataatggaatgcaagaatggagaatgggtggctcttaatccattgaggatatgt
cagaaaaggccctgtggacatcctggagatactccttttggttcctttcatcttgcaaga
ggaaatgaatttgaatatggagcaaaggttgtttacacatgtaatgaggggtatcagatg
ctaggtacaattaatttccgtgagtgtgatcctgatggatggaccaatgatattcctata
tgtgaagttgttaagtgtttaccagtgacacatccagagaatgggagattgaccagtagt
gcattggaactagacaaggaatatacttttggacaagtagtacggtttgtgtgcaattca
ggcttcatgcttgttgggcctgcagaaatacgttgctcaacaaatggtgtgtggagtgga
gaaagcccaaaatgtgtggaaatttcctgccaaaagccagaaatcgcaaatggaaatgct
gcatctctgaagaaaacttacaaggaaaacgaacgatttcaatatacatgtcaccagggt
tatgaatacagtagtaaaggagatgccatatgcacagcatcgggatggactccaacccct
tcatgtaaagaaatcatatgtgcttctcctcacattcaaaatggtaactatgcaccagaa
agcatcagatacagaagtggagatgaaatcacatacaattgtaaaactggctttgatcgt
tcaacccaaggaaatacggcaacatgtacgaatagaggctgggtacctcagccaggatgt
actaggaatcgttgtgattttccacaaataaaacatggtagtctatactatgaaattatc
tatagactagactttccagtacgtgtaggaaaaaaatattggtattcctgtaagaccaat
tttgtgactgcttcacaagagccctgggaatatattcattgcacaaaagaaggatggtca
ccagaagtaccatgccgcagacaatgtattttcaatcatttgaaaaatggagataaccca
aaacaaggagtaaaatacatacaaggtgaatctgtaagagttaactgccatgctggctac
agtcttcaaaatgagcagactgtgatgacctgtacagagggtggctggttccctcctccc
gagtgcattcttctcaaaacatgttcaaaatcagagataacaattgaaaatggatttttt
tctcaatatgaacttacatattacttaaataaagaaacacagtatcaatgtaagccagga
tatgtaacaccagatggtaaaacttcaggatcggttagatgtctgaaaagtggatggtca
cctcaacccacatgtattaaatcttgtgacatgccagcatttgagaatgccaaagccaaa
agcagtggcacatggtttaaactcaatgacaagttggactacgaatgccacgatggatac
gaaagccaagatgggcgtgcaggttcaatagtgtgtgggaacgatggttggtctcataaa
ccaatatgttatgaaaaagaatgcaagattcctgaaatagaaaataacttaaatactcag
cccagaaaagaaaaatataaagtcggagatgtgttgaaattcttctgcagacaaagactt
aaaagagttggaccagattcagttcagtgttacgactttggatggtcccctaatcttcca
acatgtaaagagcaaacaaaacagtgttctccacctcctcaactccttaatgggaaagtt
aaagaaacacagaaagaaaactatgagcacaacgatttggtggaatatgtgtgcaatcct
agatttctgatgaagggtgttaataaaattcagtgtgttgatggacagtggacagacttg
cctatttgtattgaggtggagactacatgtggagatataccagaacttaattacggctac
gctgttcagacttctaaccctccctatcaccatggagattcagtgcagttcaattgcaga
gaaggattcacaatgattggacagaaatcaattacatgtataagtggattatggacccaa
cttcctcagtgcattgcaacagatgaacttcagaagtgtaaatacagcttaactatacgt
gaggcgaatccattatacaagaccgaatttgatcataatgagaacataacttacaaatgt
agaggaaaattaaaacagaaacactcaacgtgcataaatggaagatgggatcctgaacta
aactgcacagaagtacaaatgcagtcatgcccacctccacctcagattcccaatgctcac
aagatggcaacgacggtaaattatcaggatggagaaaaagtatctgttgtctgtcaagac
aattatataattcaggatgcagaggaaatcgtgtgcaaggatggaagatggcagtcaata
ccacactgcgttgaaaaaagcccatgtcctcaaccacctcagatagagcatggaaccatt
aaatcatctccattttcagaagagatggacgaaccattgaaacctgaggtttatgtacat
ggcaccaaattaaattacagttgcgaggatggtttcaggatatctggaaaagatgagata
acgtgccacatgggaaaatggagttctccacctcggtgtgtaggactttcctgtgcgcca
ccacacttgattccacatggtattctgtctcatgtatcagacagttaccaatatggagaa
gaagtaacgtacaaatgcaccgaaggttttgagattaatggacctgcattcataagatgt
ataggaggaaaatggtcccatccaccagagtgcaaaaacacggattgttttagcttaccc
gacttcggtaatgccacacccataggccagaagaagacgttatataggtcaggagaaaaa
gtgacttataaatgtccaaataattaccttttggatgggccaaatactatccagtgtatt
aacagccaatggataggaaagccaatatgcagagatcctaatgaaaactgtgggccccct
ccgcctcttgacaatggagacatgaccacattcccaaaatcagaatatcctccaggatca
tcggttgagtaccggtgccagtccttgtatgtgcttgagggaaacaaggtcatcacatgc
agatatggacagtggtcaaaaccaccaaagtgcttagatgtgtgtataatatcagaagac
tccatggaaagacataacatacaattacgatggtcttctgtgaaaaaactgtattcccca
acaggggatactgttgaatttgaatgtaaaactggatatcgtagccagacatcacaacaa
acattccgagcaacctgttgggaggggaagctgacctatcctgtttgtgtaaaaagcaat
ggttaa

KEGG   Felis catus (domestic cat): 102900754
Entry
102900754         CDS       T02385                                 
Name
(RefSeq) complement factor H-like
  KO
K04004  complement factor H
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102900754
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102900754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    102900754
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102900754
SSDB
Motif
Pfam: Sushi cEGF
Other DBs
NCBI-GeneID: 102900754
NCBI-ProteinID: XP_023103228
LinkDB
Position
F1:complement(46959429..47078575)
AA seq 1196 aa
MRFPAQIVWLMWWTVCVAEDCKGPPPRKQTEILSGVWSEQNYPEGTQATYKCRPGYITLG
SIVMECKNGEWVALNPLKICEKRPCGHPGDTSFGTFQLERGEKFEYGAKVVYTCNEGYQM
LGSINFRECESDGWTNDVPICEEISCQKPEIANGNAASLKKTYKENERFQYTCHQGYEYS
SKGDAICTASGWTPTPSCKEFLCPSPNIQNGDYTPQSIRYRSGDEITYNCKPGFYPSNRE
KMATCTKTVWVPQPRCEKRCDFPEIKHGLLHNEYNYRRDFPVSVGKKYYYSCDHNFVTDK
KQNGGYIHCTQEGWSPAVPCRRQCIFNYLINGEYPYPAKMYFQGDSVSVNCYAGYSLQNE
QTVMTCTEDGWVPAPECLPPGNRCDFPEIKHGSLHHESNYRQNFPVRVGEKYWYSCDQNF
VTVSQKPWEHIHCTQEGWSPAVPCRRQCIFNHLKNGEYPKQGVKYVQGENVSVNCNSGHS
LQNEQTVMTCTEDGWFPPPECIPLKTCSKSEITIENGFFSEYEPTYSLNKETQYQCKPGY
VTPDGKTSGPVTCLESGWSPQPACIKSCDMPVFENAKAKSSGTWFKLNDKLDYECHDGYE
SQDGRAGSIVCGNDGWSHKPVCYEIECKIPEIEDTLNIQPKEDKYKVGDVLKFFCTQRLQ
RVGPDSVQCYDFGWSPNLPTCKEQTKQCSPPPQLLNGKVKETQKENYEHNDLVEYVCNPR
FLMKGVNKIQCVDGQWTDLPICIEVETTCGDIPELNYGYAVQTSNPPYHHGDSVEFNCRE
GFTMIGQKSITCISGLWTQLPQCIATDELQKCKYSLTIREANPLYKTEFDHNEKISYKCR
GKLEQKHSTCINGRWDPELTCTEVQMQSCPPPPQIPNAHKMANMESFFLCVLLFLGLSCA
PPHLIPHGILSHVSDSYQYGEEVTYKCTKGFEINGPAFIRCLGGKWSHPPECKNTDCFSL
PDFGNATPIGQKKTLYRSGEKVTYKCPNNYLLDGPNTIQCINSQWIGKPICRDISCGNPP
RVKNAIILDEMSKYLPGQRARYECIIPFYLVGGREVTCSNGNWTQPPQCLDPKEKCGPPP
AIDNGDMTTFPTSEYAPGSSVEYQCQSLYVLEGNKVITCRYGQWSEPPKCLDVCMVSEET
MRKHNIQLGWSSKKKRYFQTRETVQFQCNPGSRRQTSQQTFRATCWDGKLTYPVCV
NT seq 3591 nt   +upstreamnt  +downstreamnt
atgagatttccagcacagattgtttggcttatgtggtggactgtttgtgttgcagaagat
tgtaaaggacctcctccaagaaaacaaactgaaattttgtcaggtgtctggtctgaacaa
aactatccagagggaactcaggctacatataaatgccgacctggatatataactcttgga
tctattgtaatggaatgcaagaatggagaatgggtggctcttaatccactgaaaatatgt
gagaaaaggccctgtggacatcctggagatacatcttttggtacttttcaacttgaaaga
ggagaaaagtttgaatatggtgcaaaggttgtttacacatgtaatgaggggtatcagatg
ctcggtagcatcaatttccgtgagtgtgaatctgatggatggaccaatgatgttcctata
tgtgaagaaatttcctgccaaaagccagaaatcgcaaatggaaatgctgcatctctgaag
aaaacttacaaggaaaacgaacgatttcaatatacatgtcaccagggttatgaatacagt
agtaaaggagatgccatatgcacagcatcgggatggactccaaccccttcatgtaaagaa
ttcttatgtccttctcctaatattcaaaatggtgactacacgccccaaagcatcagatac
agaagtggagatgaaatcacatataattgtaaacctggcttttatccttcaaaccgagaa
aaaatggcaacatgtactaaaactgtctgggtacctcagccaagatgtgagaaacgttgt
gattttccagaaataaaacatggactactacacaatgaatataactatagacgagacttt
ccagtatctgtaggaaaaaaatattactattcctgtgaccacaatttcgtgacagataaa
aaacagaacgggggatatattcattgcacacaagaaggatggtcaccagcagtaccgtgc
cgcagacaatgtatttttaattatttgataaatggagaatatccatatccagcaaaaatg
tatttccaaggtgactctgtaagtgttaactgctatgctggctacagtcttcaaaatgag
cagactgtaatgacctgtacagaagatggctgggtgcctgctcccgaatgccttcctcct
gggaatcgttgtgattttccagaaataaaacatggtagtctacaccatgaaagtaactat
agacaaaactttccagtacgcgtaggagaaaaatattggtattcctgtgatcaaaatttt
gtgactgtttcacaaaagccctgggaacatattcattgcacacaagaaggatggtcacca
gcagtaccatgccgcagacaatgtatcttcaatcatttgaaaaatggagagtatccaaaa
caaggagttaaatatgtacaaggtgaaaatgtaagcgttaactgcaattctggccacagt
cttcaaaatgagcagactgtaatgacctgtacagaggatggctggttccctcctcctgaa
tgcattcctctcaaaacatgttcaaaatcagagataacaattgaaaatggatttttttct
gaatatgaacctacatattccttaaataaagaaacacagtatcaatgtaaaccaggatat
gtaacaccagatggtaaaacttcaggaccggttacatgtctggaaagtggatggtcacct
caacccgcatgtattaaatcttgtgacatgccagtatttgagaatgccaaagccaaaagc
agtggcacgtggtttaaactcaatgacaagttggactacgaatgccacgatggatacgaa
agccaagatgggcgcgcaggttcaatagtgtgtgggaacgatggttggtctcataaacca
gtatgttatgaaatagaatgcaagattcctgaaatcgaagataccttaaatattcagcct
aaagaagacaaatataaagtcggagatgtgttgaaattcttctgcacacaaagacttcaa
agagttggaccagattcagttcagtgttacgactttggatggtcccctaatcttccaaca
tgtaaagagcaaacaaaacagtgttctccacctcctcaactccttaatgggaaagttaaa
gaaacacagaaagaaaactatgaacacaacgatttggtggaatatgtgtgcaatcctaga
tttctgatgaagggtgttaataaaattcagtgtgttgatggacagtggacagacttgcct
atttgtattgaggtggagactacatgtggagatataccagaacttaattacggctacgct
gttcagacttctaaccctccctatcaccatggagattcagtggagttcaattgcagagaa
ggattcacaatgattggacagaaatcaattacatgtataagtggattatggacccaactt
cctcagtgcattgcaacagatgaacttcagaagtgtaaatacagcttaactatacgtgag
gcgaatccattatacaagaccgaatttgatcataatgagaagataagttacaaatgtaga
ggaaaattagaacagaaacactcaacgtgcataaatggaagatgggatcctgaactaacc
tgcacagaagtacaaatgcagtcatgcccacctccacctcagattcccaatgctcacaag
atggcaaacatggagtcattctttctttgtgtccttctttttttaggactttcctgtgcg
ccaccacacttgattccacatggtattctatctcacgtatcagacagttaccaatatgga
gaagaagtaacgtacaaatgcaccaaaggttttgagattaatggacctgcattcataaga
tgtttaggaggaaaatggtcccatccaccagagtgcaaaaacacggattgttttagctta
cccgacttcggtaatgccacacccataggccagaagaagacgttatataggtcaggagaa
aaagtgacttataaatgtccaaataattaccttttggatggaccaaatactatccaatgt
attaacagccaatggataggaaagccaatatgcagagatatttcctgtgggaatccaccc
agagtgaaaaatgctattatactggatgagatgtctaagtatctacctggtcagagggca
cgttatgaatgcatcatacctttttacctggttgggggcagagaagtgacatgttcaaat
gggaactggacacaaccacctcagtgcctagaccctaaagaaaaatgtgggccccctccg
gctattgacaatggagacatgaccacattcccaacatcagaatatgctccagggtcatct
gttgagtaccagtgccagtccttgtatgtgcttgagggaaacaaggtcatcacatgcaga
tatggacagtggtcagaaccgccaaagtgcttggatgtttgtatggtatcagaagaaacc
atgagaaaacataacatacaattaggatggtcttctaagaaaaagagatatttccaaaca
agggaaactgttcaatttcaatgtaatcctggatctcgtagacagacatcacaacaaaca
ttccgagcaacctgttgggacgggaaactgacctatcctgtttgtgtataa

DBGET integrated database retrieval system