KEGG   Felis catus (domestic cat): 101089624
Entry
101089624         CDS       T02385                                 
Symbol
PPP1R12A
Name
(RefSeq) protein phosphatase 1 regulatory subunit 12A isoform X3
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04270  Vascular smooth muscle contraction
fca04510  Focal adhesion
fca04611  Platelet activation
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101089624 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    101089624 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101089624 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101089624 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101089624 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101089624 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101089624 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101089624 (PPP1R12A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101089624 (PPP1R12A)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101089624 (PPP1R12A)
SSDB
Motif
Pfam: Ank_4 Ank_2 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 101089624
NCBI-ProteinID: XP_006933969
Ensembl: ENSFCAG00000027965
UniProt: M3WZI4
LinkDB
Position
B4:complement(105241362..105406338)
AA seq 1029 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGQINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKREKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDDEEEGKKDESSCSSEED
EEDDSESEAETDKTKPMASVTNANTSSTQAAPVAVTTPVSSGQATPTSPIKKFPTSATKI
SPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVIRSASSPRLSSSLD
NKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNS
SVNEGSAYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSS
STGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTSE
VRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTRE
QENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTPS
SSLSTMSSSLYASSQLNRPNSLVGITSAYSRGLTKENEREGEKREEEKEGEDKSQPKSIR
ERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSASDRY
DSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLK
LQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGAL
IRVISKLSK
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctcccgtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctggctgcttgctccagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggttgaaaatggagcaaatattaat
caacctgataatgaaggctggataccactacatgcagctgcttcttgtggatatcttgat
attgcagaatttttgattggtcagggagcacatgtaggagctgtcaacagtgaaggagat
acaccattagatattgctgaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagcacgaaaggaagaagaacggataatgcttagagat
gcaagacaatggctaaatagtggtcaaataaatgacgtccggcatgcaaaatctggaggc
acagcacttcacgttgcagctgcgaaaggctatacagaagttttaaagcttctaatacag
gcaggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgctgct
cactggggtaaagaagaagcatgtcgaattttagtggacaatctgtgtgatatggagatg
gtcaacaaagtgggccagacagcatttgatgtagcagatgaagatattttaggatatttg
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgggagaagaaatctcca
ttaattgaatcaacagccaatatggacaataatcagtcacagaagacctttaaaaacaaa
gagacattgattattgagccagagaaaaatgcatcccgtattgaatctttggaacaagaa
aaagttgatgatgaagaagaaggaaagaaagatgagtctagctgctctagtgaagaagat
gaggaagacgactcagaatcagaagctgaaacagataagacaaaacctatggcttctgta
actaatgccaatacatctagtacacaagcagctcctgtagctgttacaacacctgtgtca
tctggtcaggccacacctacgtcacctattaaaaagtttccaacctcagctacaaaaatt
tctcccaaagaagaagagagaaaagacgagtctcctgcatcttggaggttaggacttaga
aagactggcagttatggcgcacttgcagaaatcacagcatctaaagaggctcagaaagaa
aaagacactgcaggtgttatacgttcagcttcgagtcccagactctcctcctctttggat
aataaagaaaaggagaaagatagtaaaggaactaggcttgcatatgttgcacctacaata
ccaagacgactagccagtacgtctgacattgaagagaaagaaaacagagactcttcaagt
ttacgaacgagtagctcctatacaagaagaaaatgggaagatgatctcaaaaagaatagc
tcagttaatgaaggatcagcttaccataaaagttgctcctttggtagaagacaagatgat
ttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagctggg
cttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttcttcc
tcaacaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgaaaaa
gaaaaggacagtgttcctacggcagtgaccatccctgttgctccaactgttgtaaatgct
gcagcctcaaccacaaccctgactacaactactgctggcactgtctcctccacatcagag
gtcagggagagacgcagatcatacctcactcctgttagagatgaagagtctgaatcccaa
agaaaagcaagatctagacaagcaagacagtctagaagatcaacacagggagtaacactg
actgatcttcaggaagctgaaaaaacaataggaagaagtcgttctacccgaaccagagaa
caagaaaatgaagaaaaagaaaaagaagaaaaagaaaaacaggataaagagaagcaagaa
gaaaagaaggagtcagaaacatctagagaagatgaatataaacaaaagtactccagaaca
tatgatgagacttaccagcgttacagaccagtatccacttcaagttctaccaccccatcc
tcttcactttctaccatgagcagttcactctatgcttcaagtcaactaaacaggccaaat
agtcttgtaggtataacttccgcttactccagaggattaacaaaagaaaatgaaagagaa
ggagaaaagagagaagaggaaaaagaaggagaagataaatcacaaccgaaatcaatccga
gaacgacgacgaccaagagagaaaaggagatctacgggagtttcattttggacacaagat
agtgatgaaaatgaacaagagcaacaatcagatacagaagaaggatccaacaagaaagaa
actcagacggattccatttctagatatgaaaccagttccacatcagctagtgatcggtat
gattccttattgggtcgctctggatcatacagttacttagaagaaagaaaaccttatagt
agcaggctagaaaaggacgactcaactgactttaaaaagctttatgaacaaattctagct
gaaaatgaaaagctgaaagcacagctacatgatacaaatatggaactgacagatcttaaa
ttacaattggaaaaggccacccagaggcaagaaaggtttgctgatcggtcactattggaa
atggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagagctc
aaaatgttaccagacctaaaagcagacaaccagaggctaaaggatgaaaatggggccttg
atcagagttataagcaaactttccaaataa

KEGG   Felis catus (domestic cat): 101092809
Entry
101092809         CDS       T02385                                 
Symbol
PPP1R12C
Name
(RefSeq) LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
fca  Felis catus (domestic cat)
Pathway
fca04270  Vascular smooth muscle contraction
fca04510  Focal adhesion
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092809 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101092809 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101092809 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101092809 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101092809 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101092809 (PPP1R12C)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101092809 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 101092809
NCBI-ProteinID: XP_011287897
Ensembl: ENSFCAG00000005626
LinkDB
Position
E2:3472600..3492972
AA seq 774 aa
MSGEDGPGAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGADIAAVNSDGDLPLDLAESDAME
GLLKAEIAYRGVDVEAAKRAEEELLLRDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELXDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRSQEPQVPSSGKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIHDEDEGEEGPTEPPSTESRTLNGVSSPPPASPQSPMPPEEAPFSRRF
GLQKTGSSGALGPTDRRGAEGTPGAGLQRSASSSRLEGTSPQAEEPRLARVTPTPSRKVP
EPCALPEVSRRPPSDDPTPPSRIPGPESPVKPNVPAAPTAPPADSRDRRRSYQMPVRDEE
SESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKTPEPEKSCLDPSRRPRVPGVENSD
GPALRAEAPDGQGQGPQAAREHRKVGKEWRGPAEGEEAEPADRSPESSTSEGGPSPRSQR
QRDSQPESDEPDGGFRKLYAELHSENERLREALTETTLRLAQLKVELERATQRQERFAER
PALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKLSK
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgtcgggcgaggacggcccgggggcgggccccggggcagcggcggccgcggcccgcgag
cggcggcgggagcagctgcggcagtggggggcgcgggcgggcgccgagccgggccccggg
gagcggcgcgcccgcaccgtgcgcttcgagcgcgccgccgagttcctggcggcctgcgcg
ggcggcgacctggacgaggcgcgcctgatgttgcgcgccgcggaccccggccccggcgcc
gagctcgaccccgccgccccgccgcccgcccgcgcggtgctcgattccaccaacgccgac
ggcatcagcgccctgcaccaggcctgcattgatgagaacctggaggtggtgcgcttcctg
gtggagcagggtgccacggtgaaccaggcggacaacgagggctggacgcccctgcatgtg
gccgcctcctgtggttacctggacatcgccaggtacctcctgagccacggggctgacatt
gccgccgtcaacagcgatggggacttgcccctggacttggccgagtcggacgccatggag
gggctgctgaaggcggagattgcctaccgaggtgtggacgtggaggcggccaaacgggcc
gaggaggaactgcttcttcgtgacacgagatgctggctgaatgggggcgcgatgcccgag
gcccggcacccccgcacgggggcctctgccctgcacgtggcagccgctaagggctacatc
gaagtgatgaggctgctccttcaggccggctacgacccagagctcncggacggggacggc
tggacccccctgcacgccgcggcccactggggcgtggaggacgcctgccgcctgctggct
gagcacggtgggggcatggactcgctgacccacgcgggccaacgtccctgcgacctggct
gacgaggaggtgctgagtctgttggaggaactggcccggaagcaggaggatctgcggaac
caaaaggaagcttctcagagcagaagccaggagccccaggtgccttccagcggcaaacac
cgaaggagctccgtgtgtcgtctgagcagccgagagaagatttctctccaagacctgtcc
aaggaacgccggcctgggggggcaggggggccccccatacatgacgaggatgagggagaa
gaaggccccacagagccaccctccacagaatccagaactctcaacggagtgtcttctcca
ccacccgctagccctcagagccccatgcccccagaagaggcccccttctccaggcgcttt
ggcctccagaagacgggaagctctggtgccctgggtcccacagacaggcggggggccgag
ggcacccctggggctggcttgcagcgctcagcctcgtcctctcggctggaagggacctcc
ccgcaggctgaggagccccgcctcgccagagttacgcccaccccctcccgtaaggtgccg
gagccctgtgccctgcctgaggtctccaggcgtcctccctcggatgaccccactcctccc
tccagaattccggggcccgaatccccagtgaagccaaatgtccctgcggcccccacggcg
cccccagccgactcccgggaccggcggaggtcctaccagatgcctgtgcgggatgaggag
tctgaatctcagcggaaggctcgctctcggctcatgcgtcagtctcggaggtccacacag
ggtgtgactctcaccgacctgaaggaagcagagaaggccgcagggaagaccccagagcca
gagaaatcgtgcctggacccctctcggaggccccgagtcccgggggtggagaactctgat
ggccctgccttgagagcagaggcgcctgacgggcagggtcagggaccacaggctgccagg
gagcaccgcaaagtcggcaaagagtggagggggcctgcggagggggaggaggcggagccg
gccgaccgcagcccagagtccagcacttccgagggcggcccttcacctcgcagtcagcgg
cagcgtgactcccagccagaatcagacgagcccgatggaggcttcaggaagctgtacgca
gagctgcacagcgagaacgagcggcttcgcgaggccctgactgagaccacgctccgcctg
gcgcagctcaaggtggagttggagcgcgccacgcagaggcaggagcgctttgcagagagg
cccgccctcctggagctggagagattcgagcgcagggccctggagaggaaggcggccgag
ctggaggaggagctgaaggccctgtccgacctccgggctgacaaccagaggctcaaggat
gagaacgcagccctgatccgcgtcatcagcaaactttctaagtga

KEGG   Felis catus (domestic cat): 101092932
Entry
101092932         CDS       T02385                                 
Symbol
PPP1CB
Name
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03015  mRNA surveillance pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04720  Long-term potentiation
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04921  Oxytocin signaling pathway
fca04931  Insulin resistance
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05168  Herpes simplex virus 1 infection
fca05205  Proteoglycans in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101092932 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101092932 (PPP1CB)
   04024 cAMP signaling pathway
    101092932 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    101092932 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101092932 (PPP1CB)
   04218 Cellular senescence
    101092932 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092932 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101092932 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092932 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092932 (PPP1CB)
   04921 Oxytocin signaling pathway
    101092932 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101092932 (PPP1CB)
   04270 Vascular smooth muscle contraction
    101092932 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    101092932 (PPP1CB)
   04720 Long-term potentiation
    101092932 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101092932 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101092932 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101092932 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101092932 (PPP1CB)
   05034 Alcoholism
    101092932 (PPP1CB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101092932 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101092932 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101092932 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    101092932 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:fca03019]
    101092932 (PPP1CB)
   03041 Spliceosome [BR:fca03041]
    101092932 (PPP1CB)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101092932 (PPP1CB)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     101092932 (PPP1CB)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     101092932 (PPP1CB)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101092932 (PPP1CB)
Spliceosome [BR:fca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101092932 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 101092932
NCBI-ProteinID: XP_006930454
Ensembl: ENSFCAG00000022323
UniProt: M3XDH6
LinkDB
Position
A3:complement(119866374..119910083)
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagtctcatcacccgactgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcgaggcttatgtattaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccgctgaaaatt
tgtggagatattcatggacagtatacagatttactgcgattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggatagaggaaagcagtctttg
gaaaccatttgtttgctattggcttataaaataaaatatccagagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaaggtttaatattaaattgtggaagaccttcaccgattgttttaactgtctgcctata
gctgccattgtggatgagaagatcttctgttgtcatggaggactgtcaccagacctgcag
tctatggagcagattcggagaattatgagacccactgatgtccctgatacaggtttgctc
tgtgatttgctgtggtctgacccagataaggatgtgcaaggctggggagaaaatgatcgt
ggtgtttccttcacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gatttgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaaacga
caattggtaaccctattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattcaggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Felis catus (domestic cat): 101098766
Entry
101098766         CDS       T02385                                 
Symbol
PPP1R12B
Name
(RefSeq) protein phosphatase 1 regulatory subunit 12B isoform X5
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04270  Vascular smooth muscle contraction
fca04510  Focal adhesion
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101098766 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101098766 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101098766 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101098766 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101098766 (PPP1R12B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101098766 (PPP1R12B)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101098766 (PPP1R12B)
SSDB
Motif
Pfam: PRKG1_interact Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 101098766
NCBI-ProteinID: XP_003999425
Ensembl: ENSFCAG00000000453
LinkDB
Position
F1:43066364..43282647
AA seq 984 aa
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGTGRQAQTRRGSPRVRFEDGA
VFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQPRSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKLQSGLFKNKEKMLYEEEIPKSQEMEEESKESSSS
SSEEEEGEDEASESETEKEADKKPETIDNHSNSESKSIITEQIPAPAQNTFSASSARRFS
SSLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREALRDRGSSVYRSSSSPRISAL
LDNKDKERENKSYFSSLAPRRLSNTSDVEEKENRESAVNLVRSGSYTRQLWRDEAKGKET
PQTAVPSTYVSTYLKRTPYKSQADSTAEKTADNVSSSTPLCVITNRPPPNTANGVTTATL
LSTPGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERT
FSRSRAERQAQEQPSQKPAGTEGLEGSTEKHEPSAVPAKEAGESRQPWGGSLDEEPVYRR
LRYSAQPDKPTTPVSPSASRPTLYTSSHLLRTSRSSVPDSESSETTTNTAVAKEMDKNES
EDADVDDQSSNRLSIRERRRPKERRRGTGINFWTKDEDETDVSEEVKAALHERLSRLESG
GSNPTSSDSYGDRDRASARARREAREARLASLSSRAEEDTNRDYKKLYESALTENQKLKT
KLQEAQLELADIKSKLEKMAQQKQEKTSDRSSMLEMEKRERRALERKMSEMEEEMKVLTE
LKSDNQRLKDENGALIRVISKLSK
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcagaattggagcacctaggcgggaagcgggcggagtcggcgcgaatgcggcgggct
gagcagcttcggcgctggcggggctcgctgacagagcaggaacccgcggagcgacgaggc
accgggcggcaggcgcagactcgtcgcgggagcccaagagtccgcttcgaggacggtgct
gtcttcctggccgcttgctctagcggggacaccgacgaggtgaaaaagcttctggcaaga
ggtgcagacatcaacacggtcaacgtggacggtttgacagccctgcaccaggcctgtatt
gatgaaaatttggacatggtgaagtttctggtggagaacagagccaatgtaaaccagcag
gacaacgagggctggacaccccttcatgcagcagcttcctgtggctatctcaacatagca
gagtatttcattaaccatggagccagtgtgggtattgtgaatagtgaaggtgaagtcccc
tctgaccttgcagaagagcctgccatgaaggatcttcttctggaacaagtgaagaagcaa
ggagttgatctagagcagtcaagaaaagaagaagaacaacagatgttacaggatgcccgc
cagtggctcaacagtgggaaaatagaagacgtaaggcagcctcgttcaggggccacagcc
ctccatgtggcggctgccaagggctactctgaggtcctcagacttttaatccaggctggc
tatgaactcaatgttcaggattatgatggctggactcccctccatgctgctgcgcactgg
ggtgtgaaggaggcttgctccatcctggcggaagcactctgtgatatggatatcaggaac
aaactgggccaaacaccatttgatgtggctgatgagggtcttgtggagcacttggagatg
ctccagaagaagcagaatgtgcttcgaagtgaaaaagagacacggaataagctcatcgag
tcagacctgaacagcaagttgcagagtggactctttaagaacaaagagaagatgctctat
gaagaagagatacccaagtcccaagaaatggaggaagaaagcaaagagtccagcagctcc
agctcagaggaggaggaaggtgaagatgaagcttctgagtcagaaaccgagaaggaggca
gataaaaaaccagaaaccattgacaaccattccaactctgaaagcaagagtattattacg
gaacagataccagcaccagctcagaataccttctctgcctcttcagccaggagattctcc
tccagcctttttaacaagccggaagagcccaaagatgaatctccttcttcgtggagactg
ggactcagaaaaactggcagccacaacatgctgagtgaggtggccaattccagggaagct
ctaagggaccgaggctcttctgtctaccggtcgtcatcaagccctcggatttctgctctg
ctggacaacaaagataaggagagagaaaacaagagctattttagttcactagcaccccgg
aggctcagcaacacaagtgacgtcgaagaaaaggagaacagagaatcagctgtcaatctg
gtgaggagtgggtcctatactcggcagctgtggagagatgaagcgaagggaaaggaaact
ccgcagacagctgttccatccacctatgtatcaacctacttgaaaaggactccttacaaa
tcacaggctgactcaacagcagagaaaacagcagacaatgtctcttccagcaccccgctc
tgtgtgatcactaatcgccctccacctaacactgccaatggggttacaactgccactctg
ctctccactcctggaacagactcctctgtggaagccagggagaagaggaggtcatatctg
actcctgtacgggatgaggaagcagaatctttacggaaagcacgctccagacaagctcgg
cagactcgaaggtctactcaaggcgtgacactaacggaccttcaagaagcagaaaggaca
ttcagccggtcgagggcagaacggcaagctcaggagcagcctagccagaagcctgcgggc
actgaagggcttgagggaagcacagagaagcatgagccctcagcagtcccggcaaaggaa
gctggcgagagccgtcaaccctggggcgggagtctggatgaggagcctgtctatcgtcgc
ctgaggtattcagctcagccagacaaacccacaacaccagtgtctccttctgcatcaaga
cccactctctacaccagttcccatctgctacggacaagcagatcttcagtccctgactct
gagagttcagagaccaccacaaacactgcagttgcaaaagaaatggacaaaaatgagagt
gaagatgcagatgtggatgatcagtcctctaatagactgtccatccgtgagaggaggagg
cccaaggaacgacgaagaggcacaggcatcaatttctggacaaaggatgaagatgaaact
gacgtctctgaagaggtaaaagcagcactgcatgaaagactttctaggttggaatcagga
ggtagcaaccctaccagcagcgattcttacggtgaccgtgaccgggcttcagcaagagcc
cgacgggaggcacgggaggcccgcctcgccagcctgagcagccgcgcggaagaggacacc
aacagggattataaaaaactctacgagagtgccctaaccgaaaaccaaaaactgaaaaca
aaacttcaagaggcccagctagagctagcagatataaagtccaagcttgagaagatggcc
cagcagaaacaagaaaagacctctgaccgatcgtcgatgctggagatggagaaacgggag
aggagagccttggagcggaaaatgtccgagatggaggaggagatgaaggtgttaacagaa
ctgaaatccgacaaccagaggctgaaagatgaaaatggtgccctcatcagagtcatcagc
aaactgtccaaatag

KEGG   Felis catus (domestic cat): 101100922
Entry
101100922         CDS       T02385                                 
Symbol
PPP1CC
Name
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03015  mRNA surveillance pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04720  Long-term potentiation
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04921  Oxytocin signaling pathway
fca04931  Insulin resistance
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05168  Herpes simplex virus 1 infection
fca05205  Proteoglycans in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101100922 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101100922 (PPP1CC)
   04024 cAMP signaling pathway
    101100922 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    101100922 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101100922 (PPP1CC)
   04218 Cellular senescence
    101100922 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101100922 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101100922 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101100922 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101100922 (PPP1CC)
   04921 Oxytocin signaling pathway
    101100922 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101100922 (PPP1CC)
   04270 Vascular smooth muscle contraction
    101100922 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    101100922 (PPP1CC)
   04720 Long-term potentiation
    101100922 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101100922 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101100922 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101100922 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    101100922 (PPP1CC)
   05034 Alcoholism
    101100922 (PPP1CC)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101100922 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101100922 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101100922 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    101100922 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:fca03019]
    101100922 (PPP1CC)
   03041 Spliceosome [BR:fca03041]
    101100922 (PPP1CC)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101100922 (PPP1CC)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     101100922 (PPP1CC)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     101100922 (PPP1CC)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101100922 (PPP1CC)
Spliceosome [BR:fca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101100922 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 101100922
NCBI-ProteinID: XP_003994711
Ensembl: ENSFCAG00000011168
UniProt: M3WEL4
LinkDB
Position
D3:complement(8841909..8862871)
AA seq 337 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVTSGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatatagataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggagaatgaaatccgaggactgtgctta
aagtcccgagagatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgatatccatgggcaatactatgatttgcttcgactttttgagtacggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacagggggaagcagtca
ttggaaactatctgcctcttactggcttacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccatgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacggactgctttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgctgaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatacgaattttttgcaaag
aggcagttggtcactctgttttctgcacccaattattgtggagaatttgacaatgcaggt
gccatgatgagtgtggacgaaactctaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccgaatgccacgagacctgtaacacctccaagggttacatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

KEGG   Felis catus (domestic cat): 109492306
Entry
109492306         CDS       T02385                                 
Symbol
PPP1CA
Name
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03015  mRNA surveillance pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04720  Long-term potentiation
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04921  Oxytocin signaling pathway
fca04931  Insulin resistance
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05168  Herpes simplex virus 1 infection
fca05205  Proteoglycans in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109492306 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109492306 (PPP1CA)
   04024 cAMP signaling pathway
    109492306 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    109492306 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109492306 (PPP1CA)
   04218 Cellular senescence
    109492306 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109492306 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109492306 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109492306 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109492306 (PPP1CA)
   04921 Oxytocin signaling pathway
    109492306 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109492306 (PPP1CA)
   04270 Vascular smooth muscle contraction
    109492306 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    109492306 (PPP1CA)
   04720 Long-term potentiation
    109492306 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109492306 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109492306 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109492306 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    109492306 (PPP1CA)
   05034 Alcoholism
    109492306 (PPP1CA)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    109492306 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109492306 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    109492306 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    109492306 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:fca03019]
    109492306 (PPP1CA)
   03041 Spliceosome [BR:fca03041]
    109492306 (PPP1CA)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109492306 (PPP1CA)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     109492306 (PPP1CA)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     109492306 (PPP1CA)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109492306 (PPP1CA)
Spliceosome [BR:fca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    109492306 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 109492306
NCBI-ProteinID: XP_023095886
LinkDB
Position
D1:complement(112271273..112274526)
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggaaagaatgtacagctaacagaaaacgagatccgtggtctgtgcctc
aaatcacgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacatccatggccagtactacgaccttttgcggctatttgagtacggcggc
ttccctccagagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ttggagaccatctgcctgctgctggcctataagatcaagtacccagagaacttcttcctg
ctccgtgggaaccacgagtgtgccagcatcaaccgcatctatggcttctatgatgagtgc
aagaggcgctacaacattaaactgtggaaaaccttcaccgactgcttcaactgcctgccc
attgctgccattgtggacgagaaaatcttctgctgccatggaggcctgtccccggacctg
cagtccatggagcagattcggcgtatcatgcggccaacagacgtgcctgaccagggcttg
ctatgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgtggcgtctcctttacctttggggctgaggtagtggccaagttcctacacaaacacgac
ttggacctcatctgccgggcacaccaggtggtggaagacggctatgagttctttgccaag
cggcagctggtgacactcttctcagctcccaactactgtggcgagtttgacaacgcaggc
gccatgatgagtgtggatgagacgctcatgtgctccttccagatcctcaagcccgctgac
aagaacaaggggaaatatgggcagttcagcggcctgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaaatag

DBGET integrated database retrieval system