KEGG   Felis catus (domestic cat): 101089787
Entry
101089787         CDS       T02385                                 
Symbol
CSF3R
Name
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101089787 (CSF3R)
   04151 PI3K-Akt signaling pathway
    101089787 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089787 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101089787 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089787 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089787 (CSF3R)
   04090 CD molecules [BR:fca04090]
    101089787 (CSF3R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101089787 (CSF3R)
CD molecules [BR:fca04090]
 Proteins
  101089787 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 101089787
NCBI-ProteinID: XP_003989914
Ensembl: ENSFCAG00000013269
LinkDB
Position
C1:complement(28171321..28185022)
AA seq 839 aa
MVELGTWSLTRAALIILLLPRSLEECGHISLPTSAVRLGDSITASCTISPNCSHLGPESQ
ILWKLGTQLQLGERQQRLADGSQESTITLPPLNRPRDLLSCCLRWGNSVQILDQAELWAG
YPPAAPHNLSCLMNLTTNSLICQWEPGPHNHLPTNFTLKSFKSRDNCQTQEDSILDCVPK
DGDSHCSIPRKYLKLYRHMGIWVQAENALGTGKSPQLCLVPMDVVKLEPPTLWALAPSPE
VAPPQPGCLLLRWELWKPSLYIEQKCELRHQPQLGEASWALVGPLLPETLQYELCGLLPS
TAYVLQMRCVRWPLPGQWSDWSPSLILTTAQQAPIVRLDTWWRQRQLDPRTVDVQLFWKP
VPLDKYSGQIQGYLVRPPGQTGAVPALCNTTELSCTFHLPSEAREVVLVAYNTAGTSHPT
PVVFLESRGPPLARLHTTARDPHSLWVGWEPPSPRPRGYVIAWGLGPPSPSSSNMTWKME
HNGNISGTLLQENIRPFQLYEITVTPLYQDTVGPSQHIYAYSQEMAPSHTPELHLKHIGK
TWAQLEWEPQAPELGKSPLTHYTVFWTNAQDQSFFTTLNASSHGLVLHGLEPASLYHVCL
MASSKAGATNSTSLTLMTLALEESELHILLGLFGLLVLLICLCGASRFCCRPSRKNPLWP
SVPDPAHSSLGSWVPTIMVEEAFQLPSLRDPGMPPITKITVLEEEEKKPGPWESNDSSGT
CGLPTLVQAYVLQGDPRTPSTQPQPPSSTNDQVFYGQVLGSPTGPGPGHYLRCDSTQPLL
GGLTPSPKFYENLWFQNSPLGTPEPLVPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGGI
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggtggagctgggaacctggagcctgaccagagctgccctgattatcctgctgctcccc
agaagcctggaggaatgcgggcacatcagcctcccaacctccgctgtccgcctgggggac
tccatcacagcctcctgcaccatcagccccaactgcagccacctgggcccggagtcacag
attctgtggaagttgggaacacagcttcagctcggagagaggcagcagcgtctggcagat
ggaagccaggaatccaccatcacgctgcccccgctcaaccgcccgcgggaccttctctcc
tgctgcctgcgctggggcaacagcgtgcagatcctggaccaggctgagctgtgggcaggc
taccctcccgccgcgccccacaacctgtcctgcctcatgaacctcacaactaacagcctc
atctgtcagtgggagccaggaccccacaaccacctgcccaccaacttcaccctcaagagc
ttcaagagccgggacaactgccagacccaagaggactccatccttgactgtgtgcctaag
gacggagacagccactgctctatcccacgcaaatacctgaagttgtaccggcacatgggc
atctgggtgcaggcagagaacgcactagggactggaaagtcgccacagctgtgcctcgtt
cccatggatgtcgtgaagctggagccccccacactgtgggccctggcccccagccctgag
gtggccccaccccagccaggctgcctgctgttgcgctgggagctatggaagccgagcctc
tacatagaacagaaatgcgagctgcgccaccagccacagcttggagaagccagctgggcc
ctggtgggccccctgctccctgagaccctccagtatgagctctgtgggctcctcccatcc
acagcctacgtcctgcaaatgcgctgcgtccgctggcccctgcctggccagtggagcgac
tggagccctagcctgatactgaccaccgcacaacaggcccccatcgtcagattggacaca
tggtggcggcagaggcagctggaccccaggactgtggatgtgcagctgttctggaagcca
gtgcccttggacaaatacagcgggcagatccaagggtacctggtcagaccaccaggccag
actggggcagtcccagccctctgcaacaccacggagctaagctgcaccttccacttgccc
tcggaagcccgggaggtggtccttgtggcctataacacagcggggacctctcatcccacc
ccagtggtcttcctggagagcagaggcccgcccctggccaggctccacaccacagctcga
gacccccacagcctctgggtgggctgggagccccccagccctcggcctcggggctatgtg
attgcgtggggcctgggtccccccagccccagcagcagcaatatgacctggaagatggaa
cacaacgggaacatttccgggaccctgctgcaggagaacatcaggccctttcagctctac
gagatcaccgtgacccctctataccaggacaccgtgggaccctcccagcacatctatgcc
tactcccaagagatggccccctcccacaccccagagctgcatctaaagcacatcggcaag
acctgggcccagctggagtgggagccccaggcccctgagctggggaagagccccctgacc
cactacaccgtcttctggaccaacgctcaggaccagtccttcttcaccaccctgaatgcc
tcctcccatggcttggtcctccacggcctggaacctgccagcttgtaccacgtatgcctc
atggcttccagcaaggccggggccaccaatagtacaagccttaccctgatgactttggcc
ctagaggagtctgagctgcatatcctcctgggcctctttggcctcctggtcctgctcatc
tgtctctgtggggcttcccggttctgctgcagacccagcaggaagaatcccctctggcca
agtgtcccagacccagcccacagcagcctgggctcctgggtgcccaccatcatggttgag
gaggccttccagctgcccagccttcgggaccccggcatgccacccatcaccaagatcaca
gtactggaggaagaagagaagaagccggggccctgggagtccaacgacagctcagggacc
tgtggcctccccaccctggtccaggcctatgtgctccagggggacccaagaacaccttcc
acccagccccagcccccgtctagcaccaatgaccaggtcttttatgggcaggtgctgggc
agccccacaggcccaggtccagggcactacctccgctgtgactctactcagcccctccta
gggggccttactcccagccccaagttttatgagaacctctggttccagaacagccccctg
gggaccccagagcccctcgtcccaaaccaggaggatgattgtgtctttgggccactgctt
gacttccccctcctgcaagggctccaggtccatggggtggaggggctggggggcatctag

DBGET integrated database retrieval system