KEGG   Felis catus (domestic cat): 101089822
Entry
101089822         CDS       T02385                                 
Name
(RefSeq) hemoglobin subunit alpha-like
  KO
K13822  hemoglobin subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca05143  African trypanosomiasis
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101089822
   05143 African trypanosomiasis
    101089822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089822
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   101089822
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 101089822
NCBI-ProteinID: XP_003999021
Ensembl: ENSFCAG00000028847
UniProt: A0A1K0FUL4
LinkDB
Position
E3:complement(44468945..44469770)
AA seq 142 aa
MVLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHG
QKVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTP
AVHASLDKFFSAVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctgtctgccgccgacaagagcaacgtcaaggcctgctggggtaagattgggtcc
catgctggcgaatatggcgcagaggccctggagaggaccttctgctccttccccaccacc
aagacctacttcccccacttcgacctgagccacggctccgcccaggtcaaggcccacggc
cagaaggtggccgatgcgctgacgcaggccgtggcccacatggacgacctgcctaccgcc
atgtcggctctgagcgacctgcacgcgtacaagctgcgtgtggaccccgtcaacttcaag
ttcctgagccactgcctgctggtgaccctggcctgccaccaccccgcggaattcaccccc
gccgtccacgcctccctggacaagttcttcagcgctgtgagcaccgtgctgacctccaaa
taccgttga

KEGG   Felis catus (domestic cat): 101091307
Entry
101091307         CDS       T02385                                 
Name
(RefSeq) hemoglobin subunit beta-A/B
  KO
K13823  hemoglobin subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca05143  African trypanosomiasis
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101091307
   05143 African trypanosomiasis
    101091307
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101091307
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101091307
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 101091307
NCBI-ProteinID: XP_003992906
Ensembl: ENSFCAG00000030143
UniProt: M3WVZ4
LinkDB
Position
D1:complement(63633818..63635336)
AA seq 147 aa
MGFLSAEEKGMVNGLWGKVNVDEVGGEALGRLLVVYPWTQRFFQSFGDLSSADAIMSNSK
VKAHGKKVLNSFSDGLKNIDDLKGAFAKLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG
HDFNPQVQAAFQKVVAGVANALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggatttctgagtgctgaggagaagggtatggtcaatggcctgtggggcaaggtgaac
gtggatgaagttggcggtgaggccctgggcaggctgctggttgtctacccctggactcag
aggttctttcagtcctttggggacctatcttctgctgatgccattatgagcaacagtaag
gtgaaggctcatggcaagaaggtgctgaactccttcagtgatggcctgaaaaacatcgac
gacctcaagggcgcctttgctaagctcagcgagctgcactgtgacaagctgcacgtggat
cccgagaacttcaggctcctgggcaacgtgctggtgtgtgtgctggcccaccactttggc
catgacttcaacccccaggtgcaggctgcctttcagaaggtggtggctggtgtggccaat
gccttggcccacaagtaccattga

KEGG   Felis catus (domestic cat): 101098159
Entry
101098159         CDS       T02385                                 
Name
(RefSeq) hemoglobin subunit beta-1
  KO
K13823  hemoglobin subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca05143  African trypanosomiasis
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101098159
   05143 African trypanosomiasis
    101098159
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101098159
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101098159
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 101098159
NCBI-ProteinID: XP_003992931
UniProt: A0A2I2UXL4
LinkDB
Position
D1:complement(63629761..63631086)
AA seq 147 aa
MSFLSAEEKGLVNGLWSKVNVDEVGGEALGRLLVVYPWTQRFFQSFGDLSSADAIMSNSK
VKAHGKKVLNSFSDGLKNIDDLKGAFAKLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG
HDFNPQVQAAFQKVVAGVASALAHRYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atgtcgtttctgagtgctgaggagaagggtctggtcaatggcctgtggagcaaggtgaac
gtggatgaagttggcggtgaggccctgggcaggctgctggttgtctacccctggactcag
aggttctttcagtcctttggggacctgtcttctgctgatgccattatgagcaacagtaag
gtgaaggcccatggcaagaaggtgctgaactccttcagtgatggcctgaaaaacatcgac
gacctcaagggcgcctttgctaagctcagcgagctgcactgtgacaagctgcacgtggat
cccgagaacttcaggctcctgggcaacgtgctggtgtgtgtgctggcccaccactttggc
catgacttcaacccccaggtgcaggctgcctttcagaaggtggtggctggtgtggccagt
gccctggcccacagataccactga

KEGG   Felis catus (domestic cat): 111558266
Entry
111558266         CDS       T02385                                 
Name
(RefSeq) hemoglobin subunit alpha
  KO
K13822  hemoglobin subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca05143  African trypanosomiasis
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    111558266
   05143 African trypanosomiasis
    111558266
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111558266
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   111558266
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 111558266
NCBI-ProteinID: XP_023102549
LinkDB
Position
E3:complement(44464474..44465299)
AA seq 142 aa
MVLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHG
QKVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTP
AVHASLDKFFSAVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctgtctgccgccgacaagagcaacgtcaaggcctgctggggtaagattgggtcc
catgctggcgaatatggcgcagaggccctggagaggaccttctgctccttccccaccacc
aagacctacttcccccacttcgacctgagccacggctccgcccaggtcaaggcccacggc
cagaaggtggccgatgcgctgacgcaggccgtggcccacatggacgacctgcctaccgcc
atgtcggctctgagcgacctgcacgcgtacaagctgcgtgtggaccccgtcaacttcaag
ttcctgagccactgcctgctggtgaccctggcctgccaccaccccgcggaattcaccccc
gccgtccacgcctccctggacaagttcttcagcgctgtgagcaccgtgctgacctccaaa
taccgttga

DBGET integrated database retrieval system