KEGG   Felis catus (domestic cat): 101090401
Entry
101090401         CDS       T02385                                 
Symbol
C5
Name
(RefSeq) complement C5
  KO
K03994  complement component 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04610  Complement and coagulation cascades
fca04613  Neutrophil extracellular trap formation
fca04936  Alcoholic liver disease
fca05020  Prion disease
fca05133  Pertussis
fca05150  Staphylococcus aureus infection
fca05168  Herpes simplex virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101090401 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101090401 (C5)
   04613 Neutrophil extracellular trap formation
    101090401 (C5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101090401 (C5)
   05168 Herpes simplex virus 1 infection
    101090401 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101090401 (C5)
   05150 Staphylococcus aureus infection
    101090401 (C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101090401 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    101090401 (C5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101090401 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101090401 (C5)
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   101090401 (C5)
SSDB
Motif
Pfam: TED_complement MG1 MG4 A2M NTR A2M_BRD A2M_recep MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 101090401
NCBI-ProteinID: XP_023098426
Ensembl: ENSFCAG00000000645
LinkDB
Position
D4:complement(82115500..82203289)
AA seq 1680 aa
MGLWGILVFLIFLGKSWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISLKSYP
DKKFSYSSGYVTLSMENKFQNSAVLTVQPKQLSGGQNPVSHVYLEVVSKHFSRSKKVPIT
YDNGFLFIHTDKPVYTPQQSVKVRVYSLNDDLKPAKRETVLTYIDPEGSEVDIMEENDYT
GIISFPDFKIPSNPKYGVWTIRAKYKEDFSTTATAYFEIKEYVLPHFSVSIEPENSFIGY
KDFNDFEITIKARYFYNKVVTEAEVYITFGIRDDLKDDQKEMMQKALQNTMLINGIAQVT
FNSEMATKELSYESLEDLNDKYLYIGVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFMKPGIPYSIKVQVKNSFDQLVGGVPVTLSAQTVDVNQEMSNLESKKSVTHSSDGVASF
MVNLPSGARMLEFNVKTDDPDLPEENQAGKVYQAIAYSSLSQSYLYIDWTGNYKPLLVGE
YLNVIVTPRSPYINKITHYNYLILSKGKIVHFGTREKLPDSSYQNINIPVTQNMVPSARL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPSADASYSPSQHVSLNMATESNSW
VALSAVDSAIYGVQRRAKKPLERVFQVLETSDLGCGAGGGRNNADVFHLAGLLFLTNANV
DDTREDDKPCKEILRPKRMLQKKIQEEVAKYKHTVLKKCCYDGAYRNEDEDCEQRAARIT
IGPRCVRIFKECCLIAKKHRDEDPLKNIQLGRLHIKTLLPVSKPEIRSYFPESWLWEVHH
VPRRSQLQFVLPDSLTTWEIQGVGISNSGICVADTLKAQVFKDVFLEMNIPYSVVRGEQI
QLKGTVYNYRMSGMRFCVKMSTVEGICTSGSQAIGHQGINPSKCLSQRVEGSSSHLVTFS
VLPLEIGLHNINFSLETSLGKEILVKTLRVVPEGIKKESYAGVTLDPRGIYGVVSRRKEF
PYRIPLDLVPKTKVKRIVSVKGLLIGEVMSTVLSQEGIDILTHLPKGNAEAELMSIVPVF
YVFHYLEAGKNWNIFSTNSLIQNQNLRKKLKEGMVSIMSYRNADSSYSMWKGGSASTWLT
AFALRVLGQLNKYIEQNQNSICNTLLWLVENCQLENGSFKENSDYQPIKLQGTLPVEARE
NTLYLTAFAVIGIRKAFDICSLMKINTAITKADTFLLENTLSAQSTFTLAIAAYALSLGD
KTHPQFRSIVSALKKKALVKGDPVIYRFWKDDLQQESTSTPSPSTAHVVETTAYALLTSL
SLKDINYVNPIIRWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLIKQLHLNMDINVSYKH
KGDLHRYKMTETNFLGRPIEVPLNDDLVVSTGYSNGVATVHVTTVVQKTSTSDEICSFHL
KIEAQDIEASSYRRYSDSDYKRIVACASYKPSKEESSSGSSHAVMDISLPTGIGANQEDL
KALVERVDQLLADYQIKDGHIILQLNSIPSDEFLCVRFRIFELFQVGFLNPATFTVYEYH
RPDKQCTMFYNPFDARLQKVCEGVTCKCIEADCGQMQTELDLTISADTRKETACKPDIAY
AYKVRITSITKENVFVKYTATLLDIYKAGEAVAQKDSDVTFIKKVTCANADLEKGRQYLI
MGKEALQIKYNFSFKYLYPLDSSTWIEYWPTNAMCPSCQAFLANLDEFAEDIFLNGCENP
NT seq 5043 nt   +upstreamnt  +downstreamnt
atgggcctttggggcatacttgtttttttaatcttcctgggtaaaagttggggacaggaa
caaacgtatgtcatttcagcgccaaaaatattccgtgtgggagcatctgaaaatattgta
attcaagtttatggctacaccgaagcatttgatgcaacaatctctcttaaaagttatcct
gataaaaaatttagttactcttcaggctatgttactttatccatggagaacaaattccaa
aactctgcagtcttaacagtacaacccaaacagttgtctggaggacagaacccagtttca
catgtgtatttggaagttgtatcgaagcatttttcaagatcaaaaaaagtgccaataacc
tatgacaatggatttctcttcattcatacagacaagcctgtttacactccacaacagtca
gtaaaggttagagtttattcactgaatgatgacctgaaaccagccaaaagagaaactgtc
ttaacttacatcgatcctgaaggttcagaagtggacattatggaagaaaatgattatacc
ggaatcatctcttttcctgacttcaagattccatccaatcctaaatacggtgtgtggaca
atccgagctaaatataaagaggacttttcaacgactgcaaccgcatattttgagattaaa
gaatatgtgttgccacatttttctgtctcaatagaaccagaaaatagtttcattggctat
aaggacttcaatgattttgaaattactatcaaagcaagatatttttataataaagttgtc
actgaagctgaagtttatatcactttcggaataagagacgacttaaaagatgatcaaaaa
gaaatgatgcaaaaagccttgcaaaacacaatgttgatcaatggaattgctcaagtcaca
tttaactctgaaatggcaactaaggaactgtcctatgaaagtctggaagatttaaacgac
aagtacctttatattggtgtcacagtcatagagtctacaggtggattttctgaagaggca
gaaattcctggcatcaaatatgtcctctctccctacaaactgaatttggttgctactcct
cttttcatgaagcccgggattccatattctatcaaggtgcaggttaagaattcatttgac
caattggtaggaggggtcccggtgaccctgagcgcacaaacggtcgatgtaaaccaagag
atgtctaacttggagtcgaagaaaagtgtaacacattccagtgatggagtagcttcgttt
atggttaatcttccatctggagcaaggatgttggagtttaacgtcaagactgatgaccca
gatcttccagaagaaaatcaagccggcaaagtttaccaagcaatagcatattcatctctc
agccaaagttacctttatattgactggactggaaactataaacctttgcttgtgggagaa
tatctgaatgttattgttacccccagaagtccatatattaacaaaataactcactataat
tacttgattttatctaagggcaaaattgtccactttggcacaagagagaaacttccagat
tcatcctatcaaaacataaacattccagtgacacaaaacatggttccttcagcccgtctc
ctggtctattacatcgtcacaggagagcagacagcagagttggtgtctgattcagtctgg
ttaaatatcgaagaaaagtgtggcaatcagctccaggttcatctgtctccaagtgcagat
gcgtcgtattctccaagccaacatgtatctcttaatatggcaactgagtcaaattcctgg
gtggctttatcagcagtggacagtgctatatatggagtccagagaagagccaagaaacct
ctggaaagagtatttcaagtcttagagacgagcgacctgggctgtggggcaggtggtggc
cgcaacaatgcagatgtattccatctggctggactcctctttctcaccaacgcaaatgta
gatgacacccgagaagatgataagccctgcaaagaaattctcaggccaaagagaatgctg
caaaagaaaatacaggaggaagttgctaaatacaaacacacagtattgaagaaatgttgc
tacgacggagcctaccgtaatgaagatgaggactgtgagcagcgtgctgcccgcattaca
ataggtcccagatgcgtcaggatcttcaaggaatgttgtcttatcgcaaagaagcaccgt
gatgaggatcctcttaaaaacatccagctgggaaggctgcatataaagaccctgttacca
gtgagcaagccagaaataaggagctattttccagaaagctggttatgggaagttcatcat
gtccccagaagaagccaattgcaatttgtgctacctgattctctaaccacctgggaaatt
caaggtgttggcatttcaaatagtggtatatgtgttgctgatactctcaaggcacaggtg
ttcaaagatgtcttcctggaaatgaatataccatattctgttgtacgaggggagcagatc
cagttgaaaggaactgtttacaactatagaatgtctggtatgcggttctgtgttaaaatg
tctaccgtggagggaatctgtacatccggaagccaagccattggccaccagggcataaat
ccctccaaatgtctgtcccagagagtagaaggttcctccagtcatttggtgaccttcagc
gtgcttcccctggaaatcggcctccacaacatcaacttttcactggagacttcacttgga
aaagaaatcttagtaaaaacattacgagtggtgccagaaggtatcaaaaaggaaagttat
gctggtgttactctggacccaaggggtatttatggtgtcgttagtagacgaaaagagttc
ccatacaggataccgttagatttggtccccaaaacaaaagtcaaaaggatcgtgagcgta
aaaggactgcttataggagaggtcatgtctacagttctgagtcaggaaggcattgacatt
cttacccacctccccaaggggaatgcagaagcagaactgatgagcattgtcccagtattc
tatgtttttcactacctggaagcaggaaaaaattggaacattttttctactaattcactt
attcaaaatcagaacctgaggaaaaaattaaaagaagggatggtgagcatcatgtcctac
agaaatgctgactcttcttacagcatgtggaagggtggcagtgctagcacttggttaaca
gcctttgctttaagagtgcttggacaattaaataagtacatagaacagaaccaaaattca
atttgtaatactttattgtggctggtggagaattgtcaactagaaaatggatctttcaag
gagaattcggactatcaaccaataaaattacagggtaccttgcctgtcgaagcccgggag
aacaccttatatctgacagcctttgctgtgattggaatcagaaaggcttttgatatatgc
tccctgatgaaaatcaacacggccatcactaaagctgacacctttctgcttgaaaatacc
ctctcagcccagagcacctttacactggccattgctgcttacgctctttccctgggagat
aaaacccacccgcagtttcgttcaattgtctcagccctgaagaagaaagctttggttaaa
ggcgatccagtcatttatcgcttttggaaagatgatcttcaacaggaaagcacatccaca
cctagccccagtacagcacacgtggtagaaaccactgcctacgctttactcaccagtctg
agcttgaaagacataaattacgttaacccaatcatcagatggctatctgaagagcagagg
tacggaggcggcttttattcaacccaggatacaattaatgccatcgagggcctgacagaa
tattcactcctgataaaacaactccacttgaatatggacatcaatgtctcttacaagcat
aaaggtgacctccaccgttataagatgacagagacgaatttccttgggaggccaatagag
gtgcccctcaatgatgacctcgtcgtcagtactgggtatagcaatggcgtggctacggtg
cacgtaacaactgtggttcagaaaaccagtacttctgacgaaatctgcagctttcatttg
aaaattgaagcccaagacatagaagcttccagctacagacgctacagcgactcagattac
aaacgcatagtagcatgtgccagctacaagcccagcaaagaagaatcatcatcgggatct
tcccatgcagtgatggatatctctttgcctactggaatcggtgcaaaccaggaagactta
aaagctcttgtggaaagggtagaccaactattagctgattaccaaatcaaagatggacat
attatcctgcaactgaattcgattccttctgatgagttcctttgtgttcggttccggata
tttgagctgtttcaagttgggtttctgaatcctgctactttcacggtgtatgaataccac
agaccagataagcagtgcaccatgttctataacccattcgatgccagactgcagaaagtc
tgtgaaggagtaacatgcaaatgcatagaagctgactgcggacagatgcagacagaattg
gatctgacaatctctgcagatactagaaaagaaacagcatgtaaaccagacattgcctat
gcttataaagttcgtatcacatccatcaccaaagaaaatgtctttgtgaagtatacggca
accctcctggacatctacaaagctggagaagctgttgcccagaaagactctgacgtcacc
ttcattaaaaaggtaacatgtgctaacgctgatctggaaaaaggaagacaatatttgatt
atgggtaaagaagccctccagataaaatacaatttcagtttcaagtacctctaccctttg
gattcgtccacctggattgaatattggcctacaaacgcaatgtgcccatcatgccaggcg
ttcttggctaatttagatgagtttgctgaagacatttttctaaatggctgcgaaaacccc
tga

DBGET integrated database retrieval system