KEGG   Felis catus (domestic cat): 101090430
Entry
101090430         CDS       T02385                                 
Symbol
SDC4
Name
(RefSeq) syndecan-4
  KO
K16338  syndecan 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04512  ECM-receptor interaction
fca04514  Cell adhesion molecules
fca05205  Proteoglycans in cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101090430 (SDC4)
   04514 Cell adhesion molecules
    101090430 (SDC4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101090430 (SDC4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101090430 (SDC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:fca00535]
    101090430 (SDC4)
Proteoglycans [BR:fca00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   101090430 (SDC4)
SSDB
Motif
Pfam: Syndecan Ycf70
Other DBs
NCBI-GeneID: 101090430
NCBI-ProteinID: XP_003983490
Ensembl: ENSFCAG00000022046
UniProt: M3X6M9
LinkDB
Position
A3:15728524..15747439
AA seq 201 aa
MASARLLALLLLLVGVPAAAPESIRETEVIDPQDLLEGRYFSGALPDDEDVGGPGQEPDD
FELSGSGDLDDSEDPRIFPEVIQPLVPLDNHIPERAGPGSWVPTEAKDLEENEVIPKRIS
PFEGDEDVSNKVSMSSATQSGNIFERTEVLAALIVGGGVGVLFAVFLVLLLVYRMKKKDE
GTYDLGKKPIYKKAPTNEFYA
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcctccgcccgcctgctcgcgctgctactgctcctcgtgggcgtccccgccgctgcc
cccgagtcgatccgagagaccgaagtcatcgacccccaagacctcctagaaggccgatac
ttttctggagccctcccagatgatgaggatgtcggggggcccgggcaggagcccgatgac
tttgagctgtctggctctggagatctggatgactcagaggacccccggatcttcccggaa
gtgatccaacccttggtgcctctagataaccatatccctgagagggcagggcctgggagc
tgggtccccaccgaagccaaggacctggaggagaatgaggtcatccccaagaggatctca
ccctttgaaggggacgaggatgtgtctaacaaggtgtccatgtccagtgccacacagagc
ggcaacatctttgagaggacagaggttctggcggctttgatcgtgggcggcggcgtgggc
gtcctgtttgctgttttcctggtcctgctgctggtataccgcatgaagaagaaggacgaa
ggcacctacgacctgggcaagaaacctatctacaaaaaagcccccaccaacgagttctat
gcttga

DBGET integrated database retrieval system