KEGG   Felis catus (domestic cat): 101091014
Entry
101091014         CDS       T02385                                 
Symbol
COLEC11
Name
(RefSeq) collectin-11 isoform X6
  KO
K10066  collectin sub-family member 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101091014 (COLEC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101091014 (COLEC11)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101091014 (COLEC11)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101091014 (COLEC11)
Lectins [BR:fca04091]
 C-Type lectins
  Group 3: Collectins
   101091014 (COLEC11)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 101091014
NCBI-ProteinID: XP_003984567
Ensembl: ENSFCAG00000031800
UniProt: A0A5F5Y2F8
LinkDB
Position
A3:complement(140837822..140870551)
AA seq 243 aa
MRRGLALLGLAFLWLLPSGRPQQTAEDACSLHILVPGLKGDAGQKGDKGAPGRPGRVGPT
GEKGEKGDSGDIGPPGPNGEPGIPCECSQLRKAIGETDNQVSQLTAELKFIKNAVAGVRE
TDSKIYLLVKEEKRYVDAQLSCQGRGGTLGMPKDEAANGLMAAYIAQAGLARVFIGINDL
EREGTFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHVTMHFLCEFDK
EHV
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaggaggggtctggctctcctcggcctggccttcctgtggctgctcccgtctgggcgt
cctcagcagacggcagaagacgcctgttccctgcacatcctcgtcccgggcctcaaaggg
gatgccggacagaagggggacaaaggtgcacccggacggcccggaagagtcggccccacg
ggagagaaaggtgaaaaaggagattctggtgacatagggccccccggccctaatggagaa
ccaggcatcccgtgtgagtgcagccagctgaggaaggccatcggggagacggacaaccag
gtcagccagctgacggcggagctgaaattcataaaaaatgctgtcgccggcgtgcgcgag
accgacagcaagatctacctgctggtgaaggaggagaagcgctacgtggacgcgcagctg
tcgtgccagggccgcgggggcacgctgggcatgcccaaggacgaggccgccaacgggctg
atggccgcctacatcgcgcaggccggcctggcccgcgtcttcatcggcatcaacgacctg
gagagggagggcacgttcgtgtactcggaccgctcgcccatgcagaccttcaacaagtgg
cgcagcggcgagcccaacaacgcgtacgacgaggaggactgcgtggagatggtggcctcg
ggcggctggaacgacgtggcctgccacgtcaccatgcacttcctgtgcgagttcgacaag
gagcacgtgtga

KEGG   Felis catus (domestic cat): 101094054
Entry
101094054         CDS       T02385                                 
Symbol
COLEC12
Name
(RefSeq) collectin-12
  KO
K10062  collectin sub-family member 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101094054 (COLEC12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094054 (COLEC12)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101094054 (COLEC12)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101094054 (COLEC12)
Lectins [BR:fca04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Scavenger receptor with a CTLD (SRCL)
    101094054 (COLEC12)
SSDB
Motif
Pfam: Collagen Lectin_C Filament ATG17_like KxDL Ly49 UL45 SERRATE_Ars2_N SepF Alpha-2-MRAP_C
Other DBs
NCBI-GeneID: 101094054
NCBI-ProteinID: XP_023097568
LinkDB
Position
D3:45556115..45752229
AA seq 742 aa
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSHLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQSQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLSSFTGQMDNI
TTASQANEQNLKDLQDVHKDAENRTAIKFSQLEKRFQLFETDIVNIISNISYTAHYLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDMMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGQQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPVGPPGERGGKGSKGLQGPKGSRGSPGKPGPQGPSGDPGPAGPPGKDGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAAMPLALQNEPTS
APEANGCPPHWKNFTDKCYYFSVEKDIFEDAKLFCEDKSSHLVFINTREEQQWIKKQIVG
RDSHWIGLTDSEHENEWKWLDGTSPEYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF
QCEDINNFICEKDRETVPPSAL
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgaaagacgactttgcagaggaggaggaggtgcagtccttcggttacaagcggtttggt
atccaggaaggaacacagtgtaccaaatgtaaaaataactgggcactgaagttttctatc
atattattatacattttgtgtgccttgctaacaatcacagtagccattttgggatacaaa
gttgtagaaaaaatggacaatgttacaggtggcatggagacatctcgccaaacctatgat
gacaagctcacagcagtggaaagcgacctgaaaaaattaggggaccaaactgggaagaaa
gctataagcaccaactcagaactctctaccttcagatcagacatactggatcttcgtcag
cagcttcgtgagattacagagaaaaccagcaagaacaaagacacgctggagaagttacag
gcaagtggggatgcgctggtggacaggcagagtcacctgaaggaaactttggagaataac
tctttcctcatcaccactgtaaacaaaaccctccaagcgtataatggctatgtcaccaat
ctacagcaagacaccagcgtgctgcagggcaatctgcagagccaaatgtactctcataac
gtggttattatgaacctcaacaacctgaacctgacccaggtgcagcagaggaacctcatc
actaatttgcagcggtctgtggatgacacgagccaggccatccagcgaatcaagaacgac
ttccaaaatctgcagcaggttttccttcaagccaagaaggacactgattggctgaaggag
aaagtgcagagtttacagacgctggctgccaataactctgccttggccaaagctaacaac
gacaccctggaggatatgaacagccagctcagttcattcacaggtcagatggacaacatc
accacagcctcacaagccaatgagcagaacctgaaagacctgcaggacgtacacaaggat
gcggagaacagaacagccatcaagttcagccagttggagaaacgcttccagctctttgag
acggatattgtgaacatcattagcaacatcagttacactgcccactacctgcggacgctg
accagcaatctgaatgaagtcaggacgacttgcacagatacgctgaccaaacacacagac
gacctgacctccttgaataacacactggccaacatccgtttggattctgtttctctcagg
atgcaacaagacatgatgaggtcaaggttagatactgaagtagccaacttatcagtaatt
atggaagaaatgaagctggtagactccaagcatggtcagctcatcaagaattttacaata
ctacaaggtcctcctggccccaggggtccaaaaggcgacagaggacagcagggaccccct
ggtcccactggcaacaaaggacaaaaaggagagaagggagagcctggtccacccggcccc
gctggtgagaggggcccaattgggccagttggcccccctggagagcgtggcggcaaaggc
tccaaaggcttgcagggccccaaaggctcccgtggatcccctgggaagcctggccctcag
ggccccagcggagacccaggccccgcaggcccaccaggcaaggatggactccctggccct
cagggccctcctggcttccagggattgcagggcaccgtgggagagccaggggtgcctgga
cctcgggggctgccaggcttgcctggggtgccaggcatgccaggcccgaagggcccccct
ggccccccaggcccatcaggggcagcgatgcccctggccctacagaatgagccaacctct
gcacctgaggccaatggctgcccacctcactggaagaacttcacagacaaatgctactat
ttttcggttgagaaagacattttcgaggatgcaaaacttttctgtgaagacaagtcttca
catcttgttttcataaacacaagagaggaacagcaatggataaaaaagcagatagtagga
agagacagccactggatcggcctcacagactcggagcacgaaaatgaatggaagtggctg
gatgggacgtctccagagtacaaaaattggaaagctgggcagccagataactggggtcat
ggccatgggccaggagaagactgtgctgggctgatttatgctgggcagtggaatgacttc
cagtgtgaagacatcaataacttcatttgcgaaaaagacagagagacagtaccaccatct
gcattataa

KEGG   Felis catus (domestic cat): 101100595
Entry
101100595         CDS       T02385                                 
Symbol
SFTPD
Name
(RefSeq) pulmonary surfactant-associated protein D
  KO
K10068  pulmonary surfactant-associated protein D
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101100595 (SFTPD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100595 (SFTPD)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101100595 (SFTPD)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101100595 (SFTPD)
Lectins [BR:fca04091]
 C-Type lectins
  Group 3: Collectins
   101100595 (SFTPD)
SSDB
Motif
Pfam: Collagen Surfac_D-trimer Lectin_C DUF4982
Other DBs
NCBI-GeneID: 101100595
NCBI-ProteinID: XP_003994161
Ensembl: ENSFCAG00000029978
LinkDB
Position
D2:41696937..41708873
AA seq 375 aa
MLLLPLSVLMLLTQPLRSLGTEMKTYFQRTAAGACTLVMCSPMENGLPGRDGRDGREGPR
GEKGDPGSPGAVGRAGTPGPAGPVGPKGENGSAGEPGPKGDSGPSGPPGPRGTPGPAGRE
GPSGKQGNVGPQGTPGPKGEAGPKGDVGVPGMQGSAGPRGPPGVKGERGAPGERGATGNA
GAVGPAGATGPPGPPGAKGPAGPKGDRGAPGDKGAKGESGLPDITALRQQVEALRGQVRH
LQNAFSQYRKVELFPNGRGVGEKIFKTGGIEKSFEDARQVCIQAGGQMASPRSAAENDAL
QQLVTVENKAAFLSITDIKTEGKFIYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGKW
NDKACGEQRLVVCEF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcttctcctccctctctccgtgctgatgctgctcacacagcccctgaggtcactggga
acagaaatgaagacctatttccagagaacagcagccggcgcctgcaccttggtcatgtgt
agccccatggagaatggcctgcctggtcgcgatggacgggatgggagagagggcccccgg
ggcgagaagggggatccaggttcgccaggagctgtagggagagcggggacgcctggacca
gctggcccagttgggcccaaaggggagaatggctctgctggagagcctggaccaaaggga
gactctggaccatctggacctccgggacctcgaggtacgcctggtccagctggcagagag
ggtccctcagggaagcagggaaatgtaggacctcaaggcacaccaggccccaaaggagag
gctgggcccaaaggagatgtgggtgtgcctggcatgcagggctctgcagggccgagaggc
cccccaggggttaaaggagagagaggtgcccctggtgagcgtggagccactggaaatgct
ggggcagtggggcctgctggagccacgggtccgccaggacctccaggtgccaaagggccc
gcaggaccgaagggggacagaggtgctcctggggacaaaggagcaaagggagagagcggg
cttccggacatcactgctctgaggcagcaggtggaggccttacgtggacaggtccgacac
ctccagaatgccttctctcagtataggaaagtggagctcttccccaatggccgaggtgtc
ggggagaagatcttcaagacaggaggtattgaaaagagttttgaggacgcacggcaggtg
tgtatacaggccgggggacagatggcgtccccacgctctgcggccgagaacgacgccctg
cagcagctggtcacagttgagaacaaggctgctttcctgagtataaccgacatcaagacg
gaaggcaagttcatctaccccaccggggagcccctggtctattccaactgggccccaggg
gagcccaacaacaatggcggcgcagagaactgtgtggagatctttaccaatggcaagtgg
aacgacaaggcctgcggagaacagcgcctggtggtctgcgagttctga

KEGG   Felis catus (domestic cat): 101100840
Entry
101100840         CDS       T02385                                 
Symbol
MBL2
Name
(RefSeq) mannose-binding protein C
  KO
K03991  mannose-binding lectin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101100840 (MBL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101100840 (MBL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101100840 (MBL2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101100840 (MBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100840 (MBL2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101100840 (MBL2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101100840 (MBL2)
Lectins [BR:fca04091]
 C-Type lectins
  Group 3: Collectins
   101100840 (MBL2)
SSDB
Motif
Pfam: Lectin_C Collagen DUF5595
Other DBs
NCBI-GeneID: 101100840
NCBI-ProteinID: XP_019668946
UniProt: A0A2I2UI11
LinkDB
Position
D2:complement(41723663..41729094)
AA seq 243 aa
MFLSSSLPVLLLCMLTASSSEIKISEDALKTCSAIACGIPGRDGRDGPKGEKGEPGQGLR
GLQGPPGKMGPPGNTGPPGAPGIKGTKGDRGDNSVVEAKLANLEAEMRRLKSELDHVEKL
QAFSLGKTPGKKFYVTNGERMPFSKVKAQCAELQGTVATPKNAEENKAIQDMAGSPAFLG
ITDEVTEGRFMYVTGGRLAYSNWKRDEPNDHGSGEDCVILLQDGLWNDISCSSSFLAVCE
FPA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgttcctgtcttcatcacttcctgtcctccttctgtgcatgctgacagcatccagctca
gaaataaaaatctccgaggatgccctgaagacctgctcagcgatcgcctgtggcatccca
ggcagagatggacgagatggacccaagggagaaaagggggaaccagggcaggggctcaga
ggcttgcagggccctccggggaaaatggggcctccgggaaacacagggcctcctggggct
ccaggaataaagggcaccaaaggagaccgtggagacaattcagttgtggaggcgaagctg
gctaacctggaggcagagatgaggagactgaaatcggaactggaccatgtcgaaaagttg
caagccttctccttgggcaaaacacctgggaagaagttctacgtgaccaacggtgaaaga
atgcctttttccaaagtgaaggcccagtgcgccgagctccagggcaccgtggccacgccg
aagaacgctgaggagaataaagccatccaggatatggccggcagccctgccttcctgggc
atcacggacgaagtgactgaaggccggtttatgtacgtgacgggagggaggcttgcctac
agcaactggaagagggatgagcctaatgaccacggctccggggaggattgtgtcatcctc
ctccaggacgggctctggaatgacatttcctgctcttcctccttcctggccgtctgtgaa
ttcccagcctga

KEGG   Felis catus (domestic cat): 101101085
Entry
101101085         CDS       T02385                                 
Name
(RefSeq) pulmonary surfactant-associated protein A-like isoform X1
  KO
K10067  pulmonary surfactant-associated protein A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05133  Pertussis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101101085
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    101101085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101085
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101101085
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101101085
Lectins [BR:fca04091]
 C-Type lectins
  Group 3: Collectins
   101101085
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 101101085
NCBI-ProteinID: XP_003994163
UniProt: A0A2I2UK03
LinkDB
Position
D2:complement(41736171..41740634)
AA seq 257 aa
MGGTTAAEAMLLSSLVLPLALLMASGTEYKAKEVCIGSPGIPGTPGSHGLPGRDGRDGIK
GDPGPPGPMGPPGGTPACSGPNGLTGAPGVAGERGVQGEPGERGPPGLPASLDEELQTTL
RDLRHQIQQAMGVLSLQESMLVVGEKVFSTNGQSVNFDVIRESCARAGGRIAVPTSPEEN
EAIASIVRKHNTYAYLGLEEGPSPGDFCYLDGAPVNYTNWYPGEPRGGGKEKCVEMYTDG
QWNNKNCLQYRLAICEF
NT seq 774 nt   +upstreamnt  +downstreamnt
atgggaggaaccactgcagcagaagccatgttgctgtcctctttggtcctccctctggcc
ttgctgatggcttccggcactgagtacaaggcgaaggaggtctgtatcggaagtcctggc
atccctggcactcctggatcccacggcctgccaggcagagatgggagagacggcatcaaa
ggagaccctgggcctccaggcccgatgggcccgcctggaggaacaccagcctgctccggg
cctaatgggctgaccggagcccctggcgtcgctggagagcgtggagtacagggggagcct
ggcgagagaggccctccagggcttccagcttctctagatgaggagctccaaaccacgctc
cgtgacttgagacatcagatccagcaggccatgggagtcctaagtttgcaggagtccatg
ctggtagtgggagaaaaggtcttctccaccaatgggcagtcggttaattttgatgtcatt
agagagtcatgtgccagagcaggtggccgcattgctgtcccgacgagcccagaagagaac
gaagccatcgccagcatcgtgaggaagcacaacacttacgcctatctgggcctggaggag
ggccccagccctggagacttctgctacctggatggggcccctgtgaattacaccaactgg
tacccaggggagcccaggggtgggggcaaagagaagtgcgtggagatgtacacagacggg
cagtggaataacaagaactgcctgcagtaccgcctggccatctgtgagttttga

DBGET integrated database retrieval system