KEGG   Felis catus (domestic cat): 101091215
Entry
101091215         CDS       T02385                                 
Symbol
TIMP3
Name
(RefSeq) metalloproteinase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101091215 (TIMP3)
   05205 Proteoglycans in cancer
    101091215 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101091215 (TIMP3)
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I35: timp family
   101091215 (TIMP3)
SSDB
Motif
Pfam: TIMP
Other DBs
NCBI-GeneID: 101091215
NCBI-ProteinID: XP_003989265
Ensembl: ENSFCAG00000029554
UniProt: A0A2I2UAQ8
LinkDB
Position
B4:129931969..129993055
AA seq 211 aa
MTPWLGLVVLLGSWSLGHWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt   +upstreamnt  +downstreamnt
atgactccctggctcgggctagtagtgctcctgggcagctggagcctggggcactggggc
gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactctgacatc
gtgatccgggccaaggtggtagggaagaagttggtgaaggaggggccctttggcacgctg
gtctacaccatcaaacagatgaagatgtaccgaggcttcaccaagatgccccacgtgcag
tacatccacacagaagcttctgaaagtctctgtggcctcaagctagaagtcaacaagtac
cagtacctgctgacaggccgcgtctacgatggtaagatgtacacaggactgtgcaacttc
gtggagaggtgggaccagctcaccctctcccagcgcaaggggctcaactaccggtatcac
ctgggttgtaactgcaagatcaaatcctgctactacctgccttgctttgtgacctccaag
aacgagtgcctctggaccgatatgctctccaatttcggctaccctggctaccagtccaaa
cactatgcctgcatccggcagaagggtggttactgcagctggtaccgaggatgggcgccc
ccggacaaaagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system