KEGG   Felis catus (domestic cat): 101091240
Entry
101091240         CDS       T02385                                 
Symbol
PLAUR
Name
(RefSeq) urokinase plasminogen activator surface receptor isoform X1
  KO
K03985  plasminogen activator, urokinase receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101091240 (PLAUR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101091240 (PLAUR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101091240 (PLAUR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101091240 (PLAUR)
CD molecules [BR:fca04090]
 Proteins
  101091240 (PLAUR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Receptors
  101091240 (PLAUR)
SSDB
Motif
Pfam: UPAR_LY6 QVR
Other DBs
NCBI-GeneID: 101091240
NCBI-ProteinID: XP_006941240
Ensembl: ENSFCAG00000005230
LinkDB
Position
E2:12720116..12735108
AA seq 335 aa
MGRPLLLSLLLLLFQTCIPASWGLQCMLCGRTGKCQVEECAPGQDLCRTTFMRMWEVGDE
LEVVERGCAHPEKSNRTMSYRTGVKIITLTEAVCGSDLCNRPRAGRPPTFPRTRSRYLEC
VSCASSDLSCERGWVQSLQCRSPGEQCLEVVTHRTLEGSPRDEHHTRGCGNLPGCPGPTG
FHNNHTFHFLQCCNTTKCNGGPVVELQNLPLNGLQCYSCEGNSTHGCSSEETSLTACRGP
MSQCLEATGSNGLGNPSYTVRGCATPSWCQSLHVAEAFSLTHLNVSCCSGNGCNHPVLDR
QPRTGGAPRHGPAHLSLTVTLLISARLWGGTLLWT
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgggccgcccgctgctgctgtcgctgctgctgctgctgtttcagacctgcattccagcc
tcctggggcctgcagtgcatgctgtgtgggaggaccgggaagtgccaggtggaagagtgt
gccccgggccaggacctctgcaggaccaccttcatgcgcatgtgggaagtaggtgacgag
ctggaggtggtggagagaggctgtgctcacccagagaaaagcaacaggaccatgagctat
cggacaggcgtgaagatcatcactcttacggaggccgtgtgtgggtctgacttgtgcaac
cgacccagagctggtcggcctcccacctttccccgaacccgaagccgttaccttgaatgt
gtttcctgcgcctcatcagacctgagctgtgagagaggctgggtccagagcctgcaatgc
cgcagccctggagaacagtgcttggaggtggtgacccaccggaccctggaaggcagtcca
agggatgagcaccacacccgcggctgtggcaaccttcctggctgcccgggccccaccggc
ttccacaacaaccacaccttccatttcctgcagtgctgtaacaccaccaaatgcaacggg
ggtccagttgtggagcttcaaaacctgcctctgaatggcctccagtgttacagctgtgag
gggaacagcacccatggatgttcctccgaagagacttccctgactgcctgccgtggcccc
atgagtcaatgtctggaagccactggcagtaatggcctgggcaacccaagctacacagtg
agaggctgtgcaaccccctcatggtgccaaagtctccacgtggctgaagccttcagcctg
acccatcttaacgtctcctgctgttctggaaacggctgtaaccatccagtcctggatcgc
cagccacgcacggggggtgccccccggcatggtcctgcccacctcagcctcaccgtcacc
ctgcttataagtgccagactatgggggggcactctcctctggacctga

DBGET integrated database retrieval system