KEGG   Felis catus (domestic cat): 101091326
Entry
101091326         CDS       T02385                                 
Symbol
CCL22
Name
(RefSeq) C-C motif chemokine 22
  KO
K21095  C-C motif chemokine 22
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091326 (CCL22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101091326 (CCL22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101091326 (CCL22)
   04062 Chemokine signaling pathway
    101091326 (CCL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101091326 (CCL22)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101091326 (CCL22)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101091326
NCBI-ProteinID: XP_003998145
Ensembl: ENSFCAG00000002939
UniProt: A0A2I2UXP9
LinkDB
Position
E2:36482889..36489187
AA seq 93 aa
MASPKILFLAVLVLLAMTLQATEAGPYGANVEDSICCRDYFRHPLPSRMLKYFYWTSDSC
RRPGVVFLTVRDREICADPRLPWVKKILQKMNP
NT seq 282 nt   +upstreamnt  +downstreamnt
atggccagcccgaagattctgttcctggctgtccttgtcctccttgctatgacacttcag
gcaactgaggcaggcccctacggcgccaacgtggaagacagcatctgctgccgagactac
ttccgccaccccctgccctctcgcatgctgaagtatttctactggacttcagactcctgc
cggaggcccggcgtggtcttccttacggtcagggaccgggagatctgtgctgaccccagg
ctgccctgggtgaagaagattctgcagaagatgaacccatga

KEGG   Felis catus (domestic cat): 493689
Entry
493689            CDS       T02385                                 
Symbol
CCL5
Name
(RefSeq) C-C motif chemokine 5 precursor
  KO
K12499  C-C motif chemokine 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04668  TNF signaling pathway
fca05020  Prion disease
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    493689 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493689 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493689 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493689 (CCL5)
   04621 NOD-like receptor signaling pathway
    493689 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    493689 (CCL5)
   04062 Chemokine signaling pathway
    493689 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    493689 (CCL5)
   05168 Herpes simplex virus 1 infection
    493689 (CCL5)
   05163 Human cytomegalovirus infection
    493689 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    493689 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493689 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    493689 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493689 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493689 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493689 (CCL5)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493689 (CCL5)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   493689 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 493689
NCBI-ProteinID: NP_001009827
Ensembl: ENSFCAG00000001259
UniProt: Q8SQ40
LinkDB
Position
E1:complement(23276060..23282999)
AA seq 92 aa
MKVSTAAFAVLLTAAAFCTPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP
AVVFVTRRKRQVCANPQKKWVRDKGINSLEMN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaggtctccacagctgcctttgcagtcctcctcactgctgccgctttctgcactcct
gcctctgcatccccatatgcctcggacaccaccccctgctgctttgcctacctctcccac
ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca
gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg
gtgcgggacaagggcatcaactctttggagatgaactag

KEGG   Felis catus (domestic cat): 493832
Entry
493832            CDS       T02385                                 
Symbol
CCL17
Name
(RefSeq) C-C motif chemokine 17 precursor
  KO
K21083  C-C motif chemokine 17
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493832 (CCL17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493832 (CCL17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    493832 (CCL17)
   04657 IL-17 signaling pathway
    493832 (CCL17)
   04062 Chemokine signaling pathway
    493832 (CCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493832 (CCL17)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493832 (CCL17)
SSDB
Motif
Pfam: IL8 DsbB
Other DBs
NCBI-GeneID: 493832
NCBI-ProteinID: NP_001009849
Ensembl: ENSFCAG00000004694
UniProt: Q8I021
LinkDB
Position
E2:36523719..36526085
AA seq 99 aa
MMSLKLLLLVMLLLGASLQVTHAARATNVGRECCLEYFKGAIPLRRLTGWYRTSGECSKD
AIVFVTIHGKSICSDPKDTRVKKTVRYLQSIMNPVPQES
NT seq 300 nt   +upstreamnt  +downstreamnt
atgatgtccctgaagctgctgctgctggtcatgctcctcctgggggcttctctgcaggtc
acccatgcagctcgagcaaccaacgtgggccgggagtgctgcctagagtacttcaaaggg
gccatccctctcagaaggctgacagggtggtacaggacctcgggggagtgttccaaagac
gccatagtgtttgtaactatccatggcaagtccatctgttccgaccccaaggacaccagg
gtgaagaagacagtcagatatttgcaaagcatcatgaaccctgtgccccaggagtcctga

DBGET integrated database retrieval system