KEGG   Felis catus (domestic cat): 101091467
Entry
101091467         CDS       T02385                                 
Symbol
CSF1
Name
(RefSeq) macrophage colony-stimulating factor 1 isoform X1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04151  PI3K-Akt signaling pathway
fca04380  Osteoclast differentiation
fca04640  Hematopoietic cell lineage
fca04668  TNF signaling pathway
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101091467 (CSF1)
   04014 Ras signaling pathway
    101091467 (CSF1)
   04015 Rap1 signaling pathway
    101091467 (CSF1)
   04668 TNF signaling pathway
    101091467 (CSF1)
   04151 PI3K-Akt signaling pathway
    101091467 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091467 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101091467 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101091467 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101091467 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101091467 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091467 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101091467 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101091467 (CSF1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  CSF and other factors
   101091467 (CSF1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 101091467
NCBI-ProteinID: XP_023114733
Ensembl: ENSFCAG00000010770
LinkDB
Position
C1:94121972..94141129
AA seq 569 aa
MTARGAAGRCPPTTWLSRLLLLVCLLVSRSITEEVSERCSHMIGNGHLQFLQQLIDSQME
TSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLS
SCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSS
QDVVTKPDCNCLYPKATPTSDLASVSPQQPLAPSTAPMAGLTRADSEGTEGGSLLPSELP
LRTVDLDPGTAKQRPPRSTCQSFDSPEPPGVEASPIGDSPQPQSSAGAPTPGMEHILDSV
LGTNWTLEEASGEASEGPVPQGAELSSSRPGGGSIQAKMTARPSDLLSASFPLSYSARSQ
QPEDMTSIPLPTVGPARPTGQAQSHTPEKTDRPSAKPRDHQEPGSARTPSRPPRSLSSLR
IPSRPPRSPGSPSALSAQPGLPGSHSWGHVLPLRELEGRRSTRDRRSPTELEGQASEGHR
PSARFNSVPLTDTGHDRQQEGPSDPQLPGFVFRLLVPSIILVLLAVGGLLFYRQRWRSHR
EPQTVDSPMERPEGSPLTQDEDRQVELPV
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgccgggcgctgccctcccacgacatggctgagccgcctgcta
ctgctggtctgtctcctggtgagcaggagtattaccgaggaggtgtcagagcgctgtagc
cacatgattgggaacggacacctgcagttcctgcagcagctgattgacagtcagatggag
acttcgtgccaaattgcctttgagtttgtagaccaggagcagttgaaagatcccgtgtgc
taccttaagaaggcctttctcctagtgcaagacataatggaggacaccatgcgcttcaaa
gacaatactcccaatgccaatgtcatcgtgacgctccaggaactctctctgaggctaagc
agctgcttcaccaaggactatgaagagcaggacaaggcctgtgtacgaactttccatgag
acacccctccagttgctggaaaagatcaagaatgtctttaatgaaacaaagaatctcctt
aaaaaggactggaacgttttcagcaagaactgcaacaagagctttgagaaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccacccctaccagt
gacctggcctctgtctcccctcagcagccccttgccccctccacggcccccatggctggc
ttgacccgggctgactctgaggggacagagggcggctccctcttgcccagtgagctgccc
ctccgcacagtggacctggacccgggcactgccaagcagcgaccacccaggagcacctgc
cagagctttgactctccagagcccccgggtgtagaggccagtcctatcggagactcacct
cagccccagtcctctgccggggcccccacccctgggatggagcacattcttgactctgtg
ttaggcactaactggaccctagaagaggcctccggagaggctagtgagggtcccgtaccc
caaggggcagagctttcctcctccaggccgggaggaggcagcatccaggccaagatgacc
gccaggcccagtgacctcttgtcagcatcttttccattgtcctactcagccaggagccag
cagccagaggacatgactagcatacccctgcccacggtgggccctgcgagacccactggc
caggcccagagtcatacacctgagaagacagaccgtccatctgccaagcccagagaccac
caggagccaggctctgccaggaccccgtcgcggcccccacgaagcctcagcagtctcagg
atcccgtcacggcctccacgaagccccggcagtccctcggccctctctgcacagccaggt
cttcccggaagccactcctggggccatgtgctgcccctcagggagttggagggcagaagg
agcaccagggatcggaggagccccacagagctggaaggacaagcaagtgaggggcacagg
ccctcggcccgctttaattccgttcctttgactgacacaggccatgacaggcagcaggag
ggaccctcagaccctcagctccccgggtttgtcttccgcctgctggtgcccagcatcatc
ctggtcctgctggccgtcggcggcctcctgttctacaggcagagatggcggagccatcga
gagcctcagacagtggattctcccatggagcgaccagagggcagccccctgacccaggat
gaggacagacaggtggagcttccagtatag

DBGET integrated database retrieval system