KEGG   Felis catus (domestic cat): 101091689
Entry
101091689         CDS       T02385                                 
Symbol
ALK
Name
(RefSeq) ALK tyrosine kinase receptor isoform X2
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca05200  Pathways in cancer
fca05223  Non-small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091689 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101091689 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101091689 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101091689 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101091689 (ALK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101091689 (ALK)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   101091689 (ALK)
CD molecules [BR:fca04090]
 Proteins
  101091689 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr MAM Pkinase Gly_rich Ldl_recept_a FXa_inhibition
Other DBs
NCBI-GeneID: 101091689
NCBI-ProteinID: XP_003984408
Ensembl: ENSFCAG00000001792
LinkDB
Position
A3:118882145..119557810
AA seq 1625 aa
MGALGLLGLLLLLLSAAALGSGTGTGTGTGTGHLAGSPAVGPALQPREPLSYSRLQRKSL
AVDFVVPSLFRVYARDLLLPPSSFLEPRARRPEARGSLALDCAPLLRLVGQPPGVSWTEG
SSSPAPAQARTLTRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPEEVIAGLLQFNLS
ELFSWWIHHGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQILGIGHSSSESPT
NLPSPPPDPFVWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWR
RVPSEEASQMDLLDGPETEHSKEMPRGSFLLLNTSANSKHTILSPWMRSSSEHCSLAVSV
HRHLQPSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRIGRPENPFRVALEYISSGN
RSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHRDCAQGEDEGQLC
SKLPAGFYCNFEDGFCGWTQGTLAPHTSQWQVRTLKDARVQDHQGHALLLSTTDVPTSES
ATVTSTTFPAPMKNSPCELRMSWLIRGVLQGNVSLVLVENKTGKEQSRMVWHVATNEGLS
LWQWTVLPLLDVADRFWLQIVAWWGQGSRATVAFDNISISLDCYLTISGEDKVSQDTAPK
SRNLFERNPNKEPKPWENTPRETPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLS
VVVGSEGPLKGIQTWKVPVTDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKGDTL
YILVGQQGEDACPSTNRLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMK
DGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLW
SGKSLLEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMD
GEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHG
TVLAEDGVSCIVSPTPEPHLPLSLVLSVVTSALVAALVLAFSGIMIVYRRKHQELRAMQM
ELQSPEYKLSKLCTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVY
EGQVSGVPSDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALP
RFILLELMAGGDLKSFLRETRPRPNQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIA
ARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTD
TWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPE
DRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPMRPQDPEGIPPLLVSPPQA
KREEGQDPAAPPPLPSTSSGKASKKPTAAELSVRVTRGPAVEGGHVNMAFSQSNPPSELH
KVQGSRNKPTSLWNPTYGSWFTEKPTKKNNPPAKKEHHERGNLGREGSCTVPPNVATGRL
PGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATTAPGTSHYEDTILK
NQPGP
NT seq 4878 nt   +upstreamnt  +downstreamnt
atgggagccttagggctcctagggctgctgctactgctgctttcagcggcagccttgggc
tccggaaccggaaccgggaccgggactggcaccggccatctcgccggctcacccgccgtg
ggaccagctctgcagcctcgggagcctctcagctactcacgtctgcagaggaagagcctg
gcggtggactttgtggtgccctcgcttttccgtgtctatgctcgggacctgctgctgccg
ccttcgtccttcttggagccgagggccagacggcctgaggcacgcggctccttggctctc
gactgcgccccactacttaggctggtagggcaaccgcccggggtctcctggacggaaggc
tccagctcgccagcccctgcccaggcacggacgctgaccagggtgctgaagggcggctcg
gttcgcaagctccggcgcgccaagcagctggtactggagctgggagaggaggcgatcctt
gagggctgtgtcgggcccccagaggaggtgattgcgggactgctccagttcaacctcagc
gagctgttcagctggtggattcaccacggcgaagggcggttgaggatccgcctgatgcca
gagaagaaggcttcggaagtgggcagagagggaaggctgtccgcggcgatccgtgcctcc
cagccccggcttctcttccagatcttggggatcggtcacagctcctcggagtctccgaca
aacctgccttctcctcctcctgatccttttgtatggaatctgacctggataatgaaagat
tccttccctttcctgtctcatcgcagtcgatacggtctggagtgcagctttgacttcccc
tgtgagctggagtactccccaccactccacgacctccggaaccagagctggtcctggcgt
cgagtcccctctgaggaggcctcccagatggacctgttggacgggcctgagacagagcac
tccaaggagatgcccagaggctccttcctgctcctcaacacctcagcaaactccaagcac
accatcctgagcccatggatgaggagcagcagcgagcactgcagcctggctgtctcagtg
cacaggcatctgcagccttctgggaggtatgtcgcccagctactgccccacaacgaggct
ggaagagagatccttctggtacccactccgggaaagcatggttggacagtgcttcaggga
agaattgggcgaccagagaacccattccgagtggccctggaatacatctctagtggaaac
cgaagcttgtctgcagtggacttctttgccctgaagaactgcagtgaaggaacatccccg
ggctccaagatggccttgcagagttccttcacctgctggaatgggacagtcctccagctc
gggcaggcctgcgacttccaccgggactgcgcccagggagaagacgagggccagctgtgc
agtaaactccctgctgggttttactgcaacttcgaagatggcttctgtggctggacccag
ggcacgctcgcaccccacacctcccagtggcaggtcaggaccctgaaggatgcccgggtc
caggaccaccaaggccatgctctgttgctcagcactactgatgtccctacttctgaaagt
gctacagtgaccagcactacgtttcccgccccgatgaagaactctccatgtgagctccga
atgtcctggctcatccgtggagtcttgcagggaaacgtctccttggtcctggtggagaac
aaaactgggaaggaacaaagtagaatggtctggcatgttgccactaatgaaggcttgagc
ctgtggcagtggacagtgctgcctcttctcgatgtggctgacaggttctggctgcagatt
gttgcgtggtgggggcaaggatccagagcgaccgtggcttttgacaatatctccatcagc
ctggactgctacctcaccatcagtggggaggacaaggtgtcacaggatacagcacccaaa
tcgagaaatctgtttgagagaaacccaaacaaggagccgaaaccctgggaaaatacacca
agagagacccccatctttgaccctacagttcactggctgttcaccacgtgcggggccagt
gggccccatggccccacacaggcccagtgtaacaacgcctaccggaattccaacctgagc
gtggtagtgggaagcgaggggcccctgaagggcatccagacctggaaggtgccagtcacc
gacacctacagcatctcaggctacggagctgctggcgggaaaggcgggaagaacaccatg
atgcggtcccacggtgtgtctgtgctgggcatcttcaacctggagaagggtgacacgctg
tatatcctggtcggacaacagggggaagacgcctgtcccagcacaaaccggttaatccag
aaagtctgcattggagagaacaacgtgatagaagaagaaatccgcgtgaacaggagtgtg
catgagtgggcaggagggggcggaggagggggcggagccacctacgtatttaagatgaag
gatggcgttccagtgcccctgatcattgcagctggcggtggcggcagggcctacggggcc
aagacagacacattccacccagagagactggaaaataactcctcggttctggggctgaat
ggcaattccggagccgcaggtggtggaggtggctggaatgataacacttccttgctctgg
tctggaaaatctttgctggagggtgccaccggaggacattcctgcccccaggccatgaag
aagtgggggtgggagacaagagggggtttcggagggggtggaggggggtgctcctcaggt
ggaggaggcggaggatatataggcggcaacgcggcctcaaacaatgaccccgagatggac
ggggaggacggggtttccttcatcagtccactgggcatcctgtacaccccagctttaaaa
gtgatggagggccatggggaagtgaatattaagcattacctaaactgcagccactgtgag
gtagatgagtgccacatggaccccgagagccacaaggtcatctgcttctgtgaccatggg
acagtgctggctgaggatggcgtctcctgcattgtgtcccccacacctgagccccacctg
ccgctctcgctggtcctgtctgtcgtgacctcagcccttgtggcggccctggtcttggct
ttctccggcatcatgattgtgtaccgccggaagcaccaggagctgcgagccatgcagatg
gagcttcagagccctgagtacaagctaagcaagctttgcacctcgaccatcatgactgac
tacaaccccaactactgctttgccggcaagacctcctccatcagtgacctgaaggaggtg
cctcggaagaacatcaccctcatccggggtctgggccatggtgcgtttggggaggtgtat
gaaggtcaggtgtctggagtgcccagtgacccaagccccctgcaagtagctgtaaagacg
ctgcctgaggtgtgttctgaacaggatgaactggatttcctcatggaagccttgattatc
agcaaattcaaccaccagaacatcgtgcgctgtattggggtgagtctgcaagccctgccc
cgatttatcctgctggagctcatggcgggaggagacctcaagtccttcctccgggagacc
cgtcctcgcccgaaccagccctcctccctggccatgctggaccttctgcacgtggctcgg
gacatcgcctgtggctgtcagtatttggaggaaaatcacttcatccaccgggacattgct
gccaggaactgcctcttgacgtgtccaggccctggccgagtggccaagatcggagacttt
ggaatggcccgagacatctacagagcgagctactaccgaaagggaggctgtgcgatgctg
ccggtcaaatggatgcctccagaagccttcatggaaggaatatttacttctaaaacagac
acgtggtcctttggagtgctgctgtgggaaatattttctcttggatacatgccataccct
agcaaaagcaaccaggaagttctggagttcgtcaccagcggaggacggatggacccacct
aagaactgtcctgggcccgtataccggataatgacccagtgctggcaacatcagcctgaa
gataggcccaactttgccataattttggagaggattgaatactgcacccaggacccagac
gtgatcaacaccgctttgcccatagagtatggcccactcgtggaggaggaagaaaaggtg
cccatgaggccccaagacccggagggtattcctcctctcctagtctcccctccacaagct
aaacgggaggaagggcaggatccagctgccccgccccctctgccttccacctcctccggc
aaagcctccaagaaacccacggccgcagagctctctgttcgcgtcaccagagggcccgcc
gtggaagggggacacgttaatatggcgttctctcagtccaacccgccatcagagctacac
aaagtccagggatccagaaacaaacccaccagcctatggaacccaacttatggctcatgg
tttacagagaaacccaccaaaaagaacaatcctccggcaaagaaggagcaccatgagaga
ggaaacctgggacgtgagggaagctgtaccgtcccaccgaacgttgcaactggcagactt
ccgggcgcctctctgctcctagaaccgtcctcgctgactgccaacatgaaggaagtgcct
ctgttcaggctacgtcacttcccgtgtggaaatgtcaactatggctaccagcaacagggc
ttacctttagaggccaccactgcccctggaaccagtcattacgaggacaccattctgaaa
aaccagcctgggccctga

KEGG   Felis catus (domestic cat): 101094586
Entry
101094586         CDS       T02385                                 
Symbol
EML4
Name
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca05200  Pathways in cancer
fca05223  Non-small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094586 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101094586 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101094586 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101094586 (EML4)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     101094586 (EML4)
SSDB
Motif
Pfam: WD40 HELP ANAPC4_WD40 SlyX PKcGMP_CC
Other DBs
NCBI-GeneID: 101094586
NCBI-ProteinID: XP_019683192
Ensembl: ENSFCAG00000015377
LinkDB
Position
A3:complement(108239726..108401496)
AA seq 1012 aa
MEDSLPGLASVCVSSTLTNFCTDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALA
DVLRRLAISEDHVASVKKSVPSKAMKIFKGQPGLREAISMSCITNGSGANRKPSHTSSVA
IARKETLSSAAKSGTEKKKEKPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQT
QESKNSTPTKSIKRPLTTEKSHNSWENSDESRNKLLRAVSTSKLISKVIKNTDKHKDVII
NQAKMSTREKSNQEGEYVKMFMRGRPITMFIPSDVENYDDIRTELPPEKLKLEWVYGYRG
KDCRANVYLLPTGEIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQI
AGVDKDGRPLQPHVRVWDSVSLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEH
MLTVWDWQKKSKGAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGI
FGKYEKPKFVQCLAFLGNGDVLTGDSGGVILIWSKTTVEPTPGKGPKGVYQISKQIKAHD
GSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVG
TSRNFILRGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWT
RLVDEPGHCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTL
LAVGSHDNFIYLYVVSENGRKYSRYGKCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWD
IPSGCKLIRNRSDCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADD
FCKVHLFQYPCSKAKAPSHKYSAHSSHVTNVSFTHSDSHLISTGGKDMSIIQWKLVEKLS
LPQNEIVADGTLTKAPISSIESVMQSDTPTLPPSQPLNEAAEDESRISNSPTLLENSLEQ
TMEPSEDHIEEQSEGGSEDLGEPIFEEPSSEISKEQSEPVLTEDRQGSPPLS
NT seq 3039 nt   +upstreamnt  +downstreamnt
atggaagacagcttgcctggtctcgcttcagtgtgtgtttcctctacacttacgaacttc
tgcactgatgatagtatttctgctgcaagtacttccgacgttcaagatcgcctctcagct
cttgagttacgagttcaacaacaagaagatgaaatcactgtgctaaaggcagctttggct
gatgttttgaggcgtcttgcaatctccgaagatcatgtagcctcagtgaaaaaatcagtt
ccaagtaaagccatgaagattttcaaaggccagccaggccttcgagaagctatttctatg
tcctgtataaccaacgggagtggtgcaaacagaaagccaagccacaccagctctgtcgca
attgcaaggaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggaatctcattctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacagcctctccaaatacacagacaaact
caagaaagcaagaattctactcccaccaaaagcataaaacgaccactgacaactgaaaag
tcacataattcatgggaaaattcagatgagagtcgtaataaattattgagagcagtttca
acatcaaaattaatatcaaaagttataaaaaatacagataagcataaagatgtcatcatc
aaccaagcaaaaatgtcaacccgtgaaaaaagcaaccaagaaggagaatatgttaaaatg
tttatgcgaggtcggccaattacaatgttcattccttctgatgttgaaaactatgacgac
atcagaacagaactgcctcctgagaagctgaaactggagtgggtatatggttaccgagga
aaggactgccgtgctaatgtttaccttcttcctaccggagaaatagtgtatttcatagca
tcagtagtagtactgtttaattatgaggagagaactcagcgacactacctgggtcacaca
gactgtgtgaaatgccttgctatacatcctgacaaaattaggatcgcaactggacagatt
gctggagtggataaagatggaaggcctctgcaaccccatgtcagagtgtgggattcagtt
agtttatccactctgcaaattattggacttgggacctttgagcgtggagtaggatgcctg
gatttttcaaaagcagattcaggtgttcatttatgtgttattgatgactccaatgagcat
atgcttactgtttgggattggcagaaaaaatcaaagggagcagaaataaagacaacaaat
gaagttgttttggctgtggaattccatccaacagacgcaaataccatcataacatgtggt
aaatctcatatttttttctggacctggagtggtaattcactaacaagaaaacagggaatt
tttgggaaatatgaaaaaccaaaatttgtgcagtgtttagcattcttgggaaacggagat
gttcttactggtgactcaggtggagtcatacttatatggagcaaaactactgtagaaccg
acaccagggaaagggcctaaaggtgtttatcagatcagcaaacaaatcaaagctcatgat
gggagtgtgttcacactttgtcagatgagaaatggaatgttattaactggaggagggaaa
gaccgaaaaataattctgtgggatcatgatctgaatcctgaaagagaaatagaggttcct
gatcagtatggaacaatcagagctgtagcagaaggaaaggcagatcaatttttagtaggc
acatcacgaaacttcattttacggggaacatttaatgatggcttccaaatagaagtacag
ggtcatacagatgagctttggggtcttgccacacatccctttaaagatttgctcttgaca
tgtgctcaggacagacaggtgtgcatgtggaactcagtagaacacaggctggaatggacc
aggcttgtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggcc
ataggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttct
atccacacagatgggaatgaacagctctctgtgatgcgctactcagtagatggcaccctc
ctggctgtaggatctcatgacaacttcatttacctctatgtagtctcagaaaatggaaga
aaatatagcagatatggaaagtgcactggacattccagctatatcacacaccttgactgg
tccccagacaataaatatataatgtctaactcaggagactatgagatattgtactgggac
attccaagtggctgcaaactaatcaggaatcgatcagattgtaaggacatcgattggacg
acatatacctgcgtcctaggctttcaagtctttggtgtctggccagaaggatccgatggg
acagatatcaatgcactggtgcgatcccacaataggaaggtgatcgctgttgctgacgac
ttctgcaaagtccatctgtttcaatatccctgctccaaagcaaaggctcccagtcacaag
tacagcgcccacagcagccatgtcaccaatgtcagttttacacacagtgacagtcacctg
atttcaactggtggaaaagacatgagcatcattcagtggaaacttgtagaaaagttatct
ttgcctcaaaatgagatcgtagccgatggtactctaaccaaagcccccatctcttccatt
gaaagtgtcatgcagtctgatactcccacactgcctccttcccagcccttaaatgaggca
gctgaagacgaaagtagaataagcaattctcccacacttctggagaacagcctggaacag
accatggagcccagcgaagaccacatcgaggaacagagtgaagggggcagcgaggacctc
ggtgagcctatttttgaggagccatccagtgagataagcaaggagcagagtgagcccgtt
cttaccgaggaccggcaaggctccccacccctgtcttaa

DBGET integrated database retrieval system