KEGG   Felis catus (domestic cat): 101091895
Entry
101091895         CDS       T02385                                 
Symbol
GRM5
Name
(RefSeq) metabotropic glutamate receptor 5 isoform X1
  KO
K04604  metabotropic glutamate receptor 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04072  Phospholipase D signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04540  Gap junction
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101091895 (GRM5)
   04072 Phospholipase D signaling pathway
    101091895 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101091895 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101091895 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101091895 (GRM5)
   04720 Long-term potentiation
    101091895 (GRM5)
   04723 Retrograde endocannabinoid signaling
    101091895 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091895 (GRM5)
   05016 Huntington disease
    101091895 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    101091895 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101091895 (GRM5)
G protein-coupled receptors [BR:fca04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   101091895 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438
Other DBs
NCBI-GeneID: 101091895
NCBI-ProteinID: XP_023095116
LinkDB
Position
D1:45990762..46515400
AA seq 1208 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQ
HRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTAV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSVG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGGAGGGAGAAGGAGGAGGGPGGPEPPDAGPKGLYDVAEAEEHFPAPARPRSPSPIST
LSQRAGSASRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNSMMLSTTA
PGPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAAAPPAGGAARETP
TAGPEAAAGKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRD
YTQSSSSL
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagttctgcttttgaaagaagatgtccgtgggagtgca
cagtccagtgaaaggagggtggtggctcacatgccaggtgacatcattattggagctctc
ttttctgttcaccatcagcccacggtggacaaagttcatgagaggaagtgtggggcagtt
cgtgaacagtatggcattcagagagtggaggccatgctgcacactctggaaaggatcaac
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggattcctgctgg
cattcggctgtggccctagagcagagcattgagttcatcagggactccctcatttcttca
gaagaagaagaaggtttggtgcgctgtgtggatgggtcttcctcttccttccgttccaag
aagcccattgtaggggtcattgggcctggctccagttctgtggccattcaggtccagaac
ttgctccagcttttcaacatacctcagattgcttactcggcaacaagcatggatctgagc
gacaagactctgttcaagtacttcatgagggttgttccttcagatgcccagcaggcacgg
gccatggtggacatagtgaagaggtacaattggacctatgtgtcagctgtgcacacagaa
ggcaactatggagaaagtgggatggaggctttcaaagatatgtcagccaaggaaggaatt
tgcatcgctcattcttacaaaatctacagcaacgcaggggaacagagtttcgataagctg
ctgaagaagctcaggagtcacttgcccaaagcccgggtggtggcctgcttctgtgagggc
atgactgtgagaggtctcctgatggccatgaggcgcctgggtctagcaggagaatttttg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggaatcacaatcaagcttcaatctcccgatgtcaagtggtttgatgattat
tatctgaagcttcggccagaaacaaaccttcgaaatccttggtttcaagaattttggcag
catcgttttcagtgccggctggaagggtttgcacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgagaacacatcacgttcaagattccaaaatgggatttgtg
atcaatgctatctattccatggcctatgggctccacaacatgcagatgtccctctgtcca
ggctatgcaggcctctgtgatgcaatgaagccaattgatggacggaaacttttggactcc
ctgatgaaaaccaattttactggggtttctggagatatgatcctatttgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgat
tatatcaatgttggaagctgggataatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaaacaacatcatcagatccgtttgcagtgaaccatgtgagaaaggccagata
aaggtgatccggaagggagaagtcagctgttgttggacctgtacaccctgtaaagagaat
gaatatgtctttgatgaatacacctgcaaggcgtgccagctggggtcgtggcccactgat
gaccttacaggttgtgatctgatcccagtacagtatcttcgctggggtgaccctgaaccc
attgccgctgttgtgtttgcctgcctcggcctgctggccaccctatttgttactgcagtc
ttcatcatttaccgtgatactccagtagtcaagtcctccagcagggaactctgctacatt
atccttgctggcatctgcctgggttacttatgtaccttctgcctcattgcaaagcccaaa
cagatttattgctaccttcagagaattggtattggtctttctccagccatgagctactca
gccctcgtaaccaagaccaatcgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccaggttcatgagtgcctgtgcccagctagtgattgctttcatcctc
atatgcattcagttgggcatcatcgttgccctctttataatggagcctcctgatataatg
cacgattacccaagcattcgtgaagtctacctgatttgtaataccaccaacctaggagtt
gtcactcctcttggatacaatggtttgctgattttgagctgtaccttctatgctttcaag
accagaaacgttccagctaacttcaatgaggccaagtacatcgccttcaccatgtacacc
acctgcatcatatggctggcctttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttttcagtcagcctcagtgccacagtggcgctgggctgcatgtttgtgcca
aaagtatacatcatcctggccaaaccggagagaaacgtgcgcagcgccttcaccacatcc
accgtggtgcgcatgcatgtgggggatggcaagtcatcctcagcagccagcaggtccagc
agcctagtcaacctgtggaagaggaggggctcctctggggaaaccctaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtgtgggc
aatggtgggagagcaaccatgagcagctccaatggcaaatccgtcacgtgggcccagaac
gagaagagcagccgggggcagcacctgtggcagcggctgtccatccacatcaacaagaaa
gagaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgcggc
ctgggcgcaggcggcgcgggcggtggcgcgggggccgcgggcggcgcggggggcgcgggc
ggcggccccggcgggccggagcccccggacgccggccccaaggggctgtacgacgtggcg
gaagcggaggagcacttccccgcgcccgcgcgcccgcgctcgccgtcgcccatcagcacg
ctgagccagcgcgcgggctccgccagccgcacggacgacgacgtgccgtcgctgcactcg
gagcccgcggcgcgcagcagctcctcgcagggctcgctcatggagcagatcagcagtgtg
gtgacccgcttcaccgccaacatcagcgagctcaactccatgatgctgtccaccacggcc
cccggccccggcgtgggcgccccgctctgctcgtcgtacctgatccccaaagagatccag
ctgcccacaaccatgacgacgttcgccgaaatccagccgctgcccgccatcgaggtcacg
ggcggcgcgcagcccgcggcggcggccccgccggctgggggcgctgctcgggagacgccg
acggccgggccggaagctgcagccggcaagccggacctggaagagctggtggctctcacc
ccgccgtcccccttcagagactcggtggactcggggagtacaacccccaactcgccagtg
tcggagtcggccctctgtatcccttcgtctcccaaatatgacacacttatcataagagat
tacactcagagctcctcgtcgttgtga

KEGG   Felis catus (domestic cat): 101094104
Entry
101094104         CDS       T02385                                 
Symbol
GRM1
Name
(RefSeq) metabotropic glutamate receptor 1 isoform X2
  KO
K04603  metabotropic glutamate receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04540  Gap junction
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04730  Long-term depression
fca04742  Taste transduction
fca04915  Estrogen signaling pathway
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101094104 (GRM1)
   04020 Calcium signaling pathway
    101094104 (GRM1)
   04072 Phospholipase D signaling pathway
    101094104 (GRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101094104 (GRM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101094104 (GRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101094104 (GRM1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101094104 (GRM1)
   04720 Long-term potentiation
    101094104 (GRM1)
   04730 Long-term depression
    101094104 (GRM1)
   04723 Retrograde endocannabinoid signaling
    101094104 (GRM1)
  09157 Sensory system
   04742 Taste transduction
    101094104 (GRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101094104 (GRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    101094104 (GRM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101094104 (GRM1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101094104 (GRM1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101094104 (GRM1)
G protein-coupled receptors [BR:fca04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   101094104 (GRM1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438 FtrD-like AAA_34
Other DBs
NCBI-GeneID: 101094104
NCBI-ProteinID: XP_003986675
LinkDB
Position
B2:134473353..134907339
AA seq 1175 aa
MSLLPRGPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYG
IQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKD
GLNRCLPDGQSLPLGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDK
TLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCI
AHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLI
GSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHR
FQCRLPGHILENPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGH
VGLCDAMKPIDGSKLLDFLIKSTFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYV
HVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEY
VQDEFTCKACDLGWWPSADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFV
LYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSAL
VTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILS
YPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTC
IIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDV
VRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGGRQVPKGQHMWHRLSV
HVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEDAQPVGFSPPNSPSM
VVHRRVPTAVSTPPLPPHLTTEETPLFLADPAVPKGLPPPLQQPPPPQKSLMDQLQGVVN
NFSTGIPDFNAVLAVPGGPGNGVRSLYPPPAPPQHLQMLPLQLSTFGEEPASPPAEDEDE
DDSERFKLLQEYLFEREGNTEEDELEEEDEDLQAASKPLPEDSPALTPPSPFRDSVASGS
SVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgtcccttcttcccagaggacccggcaggaaagtgttgctggcgggagcctcgtctcag
cgctcggtggccagaatggacggagatgtcatcattggagccctcttttcagtccaccac
cagcctccggccgagaaggtgcctgagaggaagtgtggagagatcagggagcagtatggc
atccagagagtggaagccatgttccacacgttggataagattaacgcggacccggtcctg
ctgcccaacatcactctgggcagtgagatccgggactcctgctggcactcctccgtggct
ctggagcagagcattgagttcatcagggactctctgatttccattcgagatgaaaaggat
gggctcaaccggtgcctgcctgacggccagtccctccccctaggcaggactaagaagcct
attgcgggcgtgatcggcccgggctccagctccgtagccattcaagtgcagaacctgctt
cagctcttcgacatcccacagattgcgtattctgccacaagcatcgacctgagtgacaaa
actttgtacaaatacttcctgagggttgtcccttctgacactttgcaagcaagggcaatg
cttgacatagtcaaacgttacaattggacctatgtctctgcagtccacacagaagggaat
tatggggagagcggaatggatgctttcaaagagctggctgcccaggaaggcctctgcatc
gcccactcagacaaaatctacagcaatgctggggaaaagagctttgaccgactcctgcgc
aagcttcgggagaggcttcccaaggccagagtggttgtctgcttctgcgaaggcatgact
gtccgaggcctcctgagtgccatgcggcgcctgggtgttgtgggagagttctctctcatt
ggaagtgatggatgggcagacagagatgaagtcattgaaggttatgaggtggaagccaac
gggggaatcacaataaagctgcaatctccagaggtcaggtcatttgatgattatttcctg
aagctgaggctggacactaatacgaggaatccctggttccctgagttctggcaacatcgg
ttccagtgccgcctaccaggacacattctggaaaatcccaactttaaaagaatctgcaca
ggcaatgaaagcttagaagaaaactatgtccaggacagtaagatggggtttgtcatcaac
gccatctacgccatggctcacgggttacagaacatgcaccacgccctctgcccgggccac
gtgggcctctgtgatgccatgaagcccatcgacggtagcaaactcctggacttcctcatc
aagtccacattcatcggtgtgtctggagaggaagtgtggtttgatgagaaaggggatgct
cctggaaggtatgatatcatgaacctgcagtacaccgaagctaatcgctatgactatgta
catgtcggaacctggcacgaaggcgtgttgaacatcgatgattacaaaatccaaatgaac
aagagtggaatggtgcggtctgtgtgcagtgaaccttgcttaaagggtcaaattaaggtc
atacggaaaggagaagtaagttgctgctggatttgcacagcctgcaaagagaatgaatac
gtgcaagatgaattcacctgcaaagcctgtgacttagggtggtggcccagtgcagattta
acaggctgtgaacctattcctgtgcgctatcttgagtggagcaacatagaatccatcata
gccatcgccttttcctgcctgggcatacttgtcaccttatttgttactcttatctttgtg
ctgtaccgggacacaccagttgtcaaatcctccagtcgggagctctgctacattatccta
gctggcatcttcctcggttacgtgtgcccttttactctcattgccaaacccaccaccaca
tcctgctacctccagcgccttctggttggcctctcctctgccatgtgctactctgcttta
gtgaccaaaaccaaccgaattgcacgcatcctggctggcagcaaaaagaagatctgcacc
cggaagcccaggttcatgagtgcctgggcccaggtgatcatcgcctcaattctgattagc
gtgcagctaaccctggtggtaaccctgatcatcatggagccccccatgcccattctgtcc
tacccaagtatcaaggaagtctaccttatctgcaataccagcaacctgggtgtggtggcc
cctctgggctacaatggactcctcatcatgagctgtacctattatgccttcaagacccgc
aatgtgcccgccaacttcaatgaggccaaatatattgccttcaccatgtacaccacctgc
atcatctggctggcttttgtgcccatttactttgggagcaactacaagatcatcaccacc
tgctttgcagtgagcctcagtgtaacggtggccctggggtgcatgttcactcccaagatg
tacatcattattgccaagcccgagaggaatgtccgcagtgccttcaccacctctgacgta
gtccgcatgcatgttggtgatggcaagctgccctgccgctccaacacgttcctcaacatt
ttccgaagaaagaaaccaggtgcagggaatgccaattctaatggcaagtctgtgtcatgg
tctgaaccaggtggaagacaggtgcccaaaggacagcacatgtggcaccgcctctctgtg
cacgtgaagaccaatgagacggcctgcaaccaaacagccgtcatcaagcccctcactaaa
agttaccagggctctggcaagagcctgaccttttccgataccagcaccaagaccctttac
aacgtggaggaggaggatgcccagccggtcggcttcagccctcccaacagtccttccatg
gtggtgcaccgacgtgtgccaaccgcggtgagcaccccgcctctgccgccccacctgacc
acagaggagacccccctcttcctggccgacccggccgtccccaagggcttgccccctccc
ctccagcagccaccgccaccgcagaaatccctgatggaccagctacagggagtggtcaac
aatttcagcaccgggatccccgatttcaacgcggtgctcgcagtccccgggggtccgggg
aacggggtgcgctcgctgtacccgcccccggcgcccccgcagcacctgcaaatgctcccg
ctgcagctgagcaccttcggggaggagcccgcctccccgccggcagaagacgaggatgag
gacgacagcgagaggtttaagctcctccaggagtacttgttcgagcgggaagggaacacc
gaggaagatgagctggaggaggaagacgaggacctgcaggcggccagcaaacccctcccc
gaggattcacctgctctgacgcctccgtcgcctttccgcgactcggtggcctccggcagc
tcggtgcccagctcccccgtgtccgagtcggtgctctgcacccctcccaacgtgacctac
gcctccgtcattctgagggactacaagcaaagctcctccaccctgtag

DBGET integrated database retrieval system