KEGG   Felis catus (domestic cat): 101091916
Entry
101091916         CDS       T02385                                 
Name
(RefSeq) N-formyl peptide receptor 2
  KO
K04173  formyl peptide receptor-like
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04613  Neutrophil extracellular trap formation
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101091916
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101091916
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101091916
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101091916
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    101091916
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx YobI-ATPase
Other DBs
NCBI-GeneID: 101091916
NCBI-ProteinID: XP_019674167
UniProt: M3WRL9
LinkDB
Position
E2:complement(6735251..6742969)
AA seq 351 aa
METNLSIAPNEYEEILHESAGYTVLWILSLVVLGITFVLGILGNGLVIWVAGFRMARSVT
TICYLNLALADFSFTATLPFLIVSMAMKERWPFGWFLCKVIHIVVDINLFGSVFLIAFIA
LDRCICVLHPVWAQNHRTVSLATKLIIGPWIFALVLTLPVFIFLTTVNDGTGNIYCTFNF
AHWGNSIEQRLKVAITMLTIRGIIRFIIGFSMPMSIVAICYGLIAAKIRKKGMIKSSRPL
RVLTAVVASFFLCWFPFQMVALLSTVWLKQMLFEGKYKILDVLTNPTSSLAFFNSCLNPI
LYVFMGQDFRERLIHSLPASLERALTEDLSQTSDTTNKSTLPHEEAELQAM
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaaaccaacctctccatcgctccgaatgaatatgaagagatactccacgagtctgct
ggctacactgttctgtggatcctatcactggtggtgcttgggatcacctttgtccttggc
atcctgggcaatgggcttgtgatctgggtggctggcttccggatggcacgcagtgtcacc
accatctgttacctgaacttggccttggccgacttctctttcactgccactctgccattt
ctcattgtctcaatggccatgaaagaacggtggccttttggctggttcctgtgtaaggta
attcacattgtggtggacatcaacctgtttggaagtgtcttcctcattgctttcattgcc
ctggaccgctgtatttgtgtcttgcatccagtctgggcccagaaccaccgcactgtaagt
ctggctacaaaactcatcattggaccctggatttttgccctagtccttaccttgccagtt
ttcatcttcttgactacagtaaatgatggaacagggaatatatactgtactttcaacttt
gcacactggggcaacagtattgaacagaggttgaaggtggctatcaccatgttgacaatc
agagggatcatccggtttatcattggcttcagtatgcccatgtccattgttgctatctgc
tatgggctcattgctgccaagatacgtaaaaaaggcatgattaaatccagccgtccctta
agggtccttactgctgttgtggcttccttctttctctgttggttcccctttcaaatggtt
gcccttttaagcacagtctggctcaaacagatgctgtttgagggcaagtacaaaatcctt
gatgtcctgactaatccaacaagctccctggccttcttcaacagctgcctcaatccaatc
ctttacgtcttcatgggccaagacttccgagagagactgatccactccctgcctgccagt
ctggagagggcccttactgaggacttatcccagaccagtgacacaacaaacaaatccact
ttacctcatgaagaagcagagttacaggcaatgtga

DBGET integrated database retrieval system