KEGG   Felis catus (domestic cat): 101092416
Entry
101092416         CDS       T02385                                 
Symbol
SDC2
Name
(RefSeq) syndecan-2
  KO
K16336  syndecan 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca05144  Malaria
fca05205  Proteoglycans in cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101092416 (SDC2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101092416 (SDC2)
  09174 Infectious disease: parasitic
   05144 Malaria
    101092416 (SDC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101092416 (SDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101092416 (SDC2)
   00535 Proteoglycans [BR:fca00535]
    101092416 (SDC2)
CD molecules [BR:fca04090]
 Proteins
  101092416 (SDC2)
Proteoglycans [BR:fca00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   101092416 (SDC2)
SSDB
Motif
Pfam: Syndecan DUF2721 DUF5305 Peptidase_M50 Glycophorin_A ATG22 Cadherin_C_2
Other DBs
NCBI-GeneID: 101092416
NCBI-ProteinID: XP_006943382
Ensembl: ENSFCAG00000031304
UniProt: M3WXE6
LinkDB
Position
F2:45167585..45268680
AA seq 201 aa
MRRAWILLTLGLVACVSAESRAEPTSDKDMYLDNSSVEEASGVYPIDDDDYASASGSGAD
EDVESPEMTTSRPLPKIGFTSAVPKVETTTWEIQNKIPAQTKSPEEIDKEKVHLSDSERK
MDPAEDDTNVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcggcgcgcttggatcctgctcaccttgggcttggtggcctgcgtgtcggcggagtcg
agagcagagccgacatctgataaagacatgtacctcgacaacagctctgttgaagaagct
tcaggagtgtatcctattgatgatgatgactatgcttctgcatcaggctcaggagctgat
gaggacgtagagagcccggagatgaccacatcccgaccacttccaaagatagggttcact
agtgctgttcccaaagtggaaaccacgacatgggagatccagaacaagatacctgctcag
acgaagtcacctgaagaaattgataaggaaaaagttcacctgtctgactcagaaaggaag
atggacccagctgaagacgatacaaatgtgtatactgagaaacactcagacaatctgttt
aaacgaacagaagtcctggcagctgtcattgctggcggagttatcggctttctctttgca
attttccttatcctgctgttggtgtatcgcatgaggaagaaggatgaaggaagttacgac
cttggagaacgtaaaccatccagtgctgcttatcagaaggcacctactaaggagttttac
gcgtga

DBGET integrated database retrieval system