KEGG   Felis catus (domestic cat): 101092454
Entry
101092454         CDS       T02385                                 
Symbol
ITGA6
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-6
  KO
K06485  integrin alpha 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04514  Cell adhesion molecules
fca04640  Hematopoietic cell lineage
fca04810  Regulation of actin cytoskeleton
fca05145  Toxoplasmosis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101092454 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092454 (ITGA6)
   04514 Cell adhesion molecules
    101092454 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092454 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101092454 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101092454 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092454 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101092454 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101092454 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101092454 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101092454 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101092454 (ITGA6)
   05414 Dilated cardiomyopathy
    101092454 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101092454 (ITGA6)
   04515 Cell adhesion molecules [BR:fca04515]
    101092454 (ITGA6)
   04090 CD molecules [BR:fca04090]
    101092454 (ITGA6)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101092454 (ITGA6)
  Exosomal proteins of breast milk
   101092454 (ITGA6)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101092454 (ITGA6)
CD molecules [BR:fca04090]
 Proteins
  101092454 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha DUF4381
Other DBs
NCBI-GeneID: 101092454
NCBI-ProteinID: XP_023115227
Ensembl: ENSFCAG00000000430
LinkDB
Position
C1:163536292..163615375
AA seq 1091 aa
MAAAGQLWLLYLSAGLLPRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQQKPEDRR
LLLVGAPRAVALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDELTFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYQDIAVGAPYDDLGKVFIYHGSPNGINTK
PTQILEGKTPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTVFRSRPVINIQKTLTVTPNT
IDLRQKMFCGAPSGICLQVKACFEYTAKPTGYNPSISILGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQSACMEETLWLQENIRDKLRPIPITASVEIQEPTTRRRVNSL
PEILPILNSNEPKTVHRDVHFLKEGCGADNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLASITATAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKIACEPQSEINSLKLKESHNSRR
KREIAEKQTDDGRKFSLFAERKYQTLNCSMNVNCVNISCPLRGLDSKASVVLRSRLWNGT
FLEEYSKMNYLDILVRASIDVAAAAENIKLPHAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYNDNLEKKQW
ITRWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggccgccgggcagctgtggctgctctacctgtccgcgggtctcctgccccggctc
ggcgccgccttcaacttggacacccgcgaggacaatgtgatccggaaaactggggacccc
gggagcctcttcggcttctcgctggccatgcactggcagcagaagcccgaggacaggcgg
ctgttgctcgtaggggccccgcgggccgtggcccttccactccagagggccaacagaaca
ggaggcttgtacagctgcgacatcacctcccgggggccttgcacacggattgaatttgat
aatgatgctgacccttcatcagaaagcaaggaagatcaatggatgggggtcaccgtccag
agccaaggtccagggggcaaagttgtgacatgtgctcaccgatatgaaaaaaggcaacac
gtcaatacaaagcaggaatcccgcgacatctttggaaggtgttacgtcctgagtcagaat
ctcaggattgaggatgacatggatggaggagactggagtttctgcgatggccgattgaga
ggccatgaaaaatttggttcttgccagcaaggagttgcagctactttcacgaaagacttt
cattacattgtgtttggagccccaggcacttataactggaaaggcattgttcgcgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttacgaagttggt
ggagagactgaccatgacgaaagtctagttcctgttcctgctaacagttacttaggcttt
tctttggactcaggaaaaggtatcgtttctaaagatgagctcactttcgtgtccggtgct
ccaagagccaaccacagtggagctgtggttttgctgaaaagagacatgaagtctgcacat
cttctccctgagcacattttcgacggggagggtctggcatcgtcattcggctatgacgtg
gcagtggtggaccttaacaaagatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaggtcggaggtgcggtgtatgtttacattaaccagcaaggcagg
tggaataatgtgaagccaattcgtctcaatggaaccaaagattccatgtttggcattgca
gtaaaaaatattggtgacattaatcaagatggctaccaagatattgccgttggagctccc
tatgatgatctgggaaaggtttttatctatcacggatccccgaacggaataaacaccaag
ccaacacagattctcgagggtaaaacaccttattttggatattcaattgctggaaatatg
gaccttgatagaaattcctaccctgatgttgctgttggttcactctcagactcagtaact
gtgttcaggtcccggcctgtgattaatattcagaaaaccctcaccgtaacaccgaacacg
attgatctccgccagaaaatgttctgtggggcacctagtgggatatgcctccaggtgaag
gcctgttttgaatatactgccaaacccacaggttacaatccttcgatatccattttgggt
acacttgaggcggaaaaggagagaagaaaatctgggctgtcatcaagagttcagtttcga
aaccaaggctctgagcccaagtatactcaagagctaactctgaacaggcagaagcagagt
gcgtgcatggaggagaccctctggctgcaggaaaatatcagagataaactacgccccatt
cccataactgcttcagtagagatccaggagccaaccacacggaggagagtgaattcactt
ccagaaattcttccgatcctgaattcaaacgaacccaagacagttcatagagatgtgcac
ttcttaaaagagggatgtggagccgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgtacccgggaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtcccagaactagttctaaaagaccagaaggacattgctttagaaatcacagtgacaaac
agcccttccaatccaaggaaccccacaaaagacggcgatgacgctcatgaagctaaactc
attgcaacttttccggacactctgacttactcggcctacagagaattgagggctttccct
gagaaacagttgagttgtgttgccaatcagaacggctcacaagcagactgtgaacttgga
aatccttttaaaagaaattccagtgtgactttttatttgattttaagtacaactgaggtt
acctttgacaccacagatctggatattaatctgaagctggaaacaacaagcaatcaagat
aatttggcttcaattacagctacagcaaaagtggttattgaactgcttttatcggtctct
ggagttgctaaaccttcccaggtgtattttggaggaacagttgttggtgagcaagctatg
aaatctgaagatgaggtgggaagtttaatagagtatgagttcagggttattaacttgggt
aaacctctgaaaaacctcggcacagccaccttgaatatccagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggcttggaaaagatagct
tgtgagccgcaaagtgaaataaactccctgaaactaaaggagtctcacaactcaagaagg
aaacgggaaattgctgaaaaacagacagatgatggcagaaaattttctttatttgctgaa
agaaaatatcagacgcttaattgcagcatgaacgtgaactgtgtgaacataagctgtccg
ctgcgagggctggacagcaaggcctctgttgtccttcgctcgaggttatggaacggcacg
tttctagaggaatattccaaaatgaactacctggacattctcgtccgggcttccattgat
gttgctgccgctgctgagaatatcaaactgccacatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagaccgtagctcaatattcaggagtaccctggtggatcatcctagtg
gctatacttgctgggattttgatgcttgctctcttagtgtttttactctggaagtgcgga
ttctttaaacgctctaggtacgatgatagcgttccccgataccatgctgtgaggatccgg
aaggaagagcgggagatcaaagatgaaaaatataatgataaccttgaaaaaaaacagtgg
atcacaaggtggaatgaaaatgaaagctactcttaa

KEGG   Felis catus (domestic cat): 751821
Entry
751821            CDS       T02385                                 
Symbol
ITGB1
Name
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04514  Cell adhesion molecules
fca04530  Tight junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05222  Small cell lung cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    751821 (ITGB1)
   04151 PI3K-Akt signaling pathway
    751821 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    751821 (ITGB1)
   04514 Cell adhesion molecules
    751821 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    751821 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    751821 (ITGB1)
   04530 Tight junction
    751821 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    751821 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    751821 (ITGB1)
   04670 Leukocyte transendothelial migration
    751821 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    751821 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    751821 (ITGB1)
   05205 Proteoglycans in cancer
    751821 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    751821 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    751821 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    751821 (ITGB1)
   05133 Pertussis
    751821 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    751821 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    751821 (ITGB1)
   05140 Leishmaniasis
    751821 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    751821 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    751821 (ITGB1)
   05414 Dilated cardiomyopathy
    751821 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    751821 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    751821 (ITGB1)
   04515 Cell adhesion molecules [BR:fca04515]
    751821 (ITGB1)
   04090 CD molecules [BR:fca04090]
    751821 (ITGB1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    751821 (ITGB1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   751821 (ITGB1)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin beta subunits
   751821 (ITGB1)
CD molecules [BR:fca04090]
 Proteins
  751821 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 751821
NCBI-ProteinID: NP_001041625
Ensembl: ENSFCAG00000019338
UniProt: P53713
LinkDB
Position
B4:complement(30108014..30155021)
AA seq 798 aa
MNLQLIFWIGLISSICCVFGQADENRCLKANAKSCGECIQAGPNCGWCVNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKDVKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLLNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKNSEIIKIKPLGFTEEVEIILQFICECECQNEGIPSSPKCHEG
NGSFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
ATNGQICNGRGICECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDTREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttgcaactgatattctggattggactgatcagttcaatttgctgtgtgtttggc
caagcagatgaaaatagatgtttaaaagcaaatgccaaatcctgtggagaatgtatacaa
gcagggccaaattgtggatggtgtgtaaattcaacatttttacaagaaggaatgcctacg
tctgcgcgatgtgatgatttagaagctttgaaaaagaaaggttgccatccagatgacata
gaaaatcccagaggctccaaagatgtaaagaaaaataaaaatgtaacgaaccgtagcaaa
ggaacggcagagaagctccagccggaagatattactcaaatccagcctcagcagttggtt
ttgcagttgcgatcaggggagccgcagacatttacattaaaattcaagagagctgaagac
tatcctatcgacctctactaccttatggacctctcctactctatgaaagatgatttggag
aatgtcaaaagtcttggaacggatctgctgaatgaaatgagaaggattacttcagatttc
cggattggatttggctcatttgtggagaagaccgtgatgccttacattagtacaacacca
gccaagctcaggaacccttgcacaagtgaacaaaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactgataaaggggaagtatttaatgaacttgttggtaaacagcgc
atatctggaaatttggattctccagaaggtggctttgatgcaatcatgcaagttgcagtt
tgtggatcattgattggctggaggaatgttacacggctgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaatgatgtgtacacaatgagccattattatgattatccttctattgct
caccttgtccaaaaactaagtgaaaataacattcagacaatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaatttgatccctaagtcagcagtaggaacttta
tctgcaaattccagcaatgtaattcagttgattattgatgcatacaattccctttcctca
gaagtcattttggaaaacagcaaattgccagaaggagtaacaataagttacaaatcttac
tgcaagaatggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataactgcaaataaatgtccaaataagaattct
gaaatcattaaaattaagcctctgggctttactgaagaagtagaaattattcttcagttc
atctgtgaatgtgagtgccaaaatgaaggcatccctagcagtccaaagtgtcatgaagga
aatggaagcttcgagtgtggagcttgcaggtgcaacgagggacgtgttggtagacattgt
gaatgtagcacagatgaagttaacagtgaagatatggatgcttactgcaggaaagaaaac
agttcagaaatctgtagtaacaatggagagtgtgtctgtggacagtgtgtttgtaggaag
agggataatacaaatgaaatttactctggcaaattctgcgaatgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggcgtttgcaagtgtcgtgtatgtgaa
tgcaatcccaactacaccggcagcgcctgtgactgttctttggataccacttcatgcatg
gccacaaatggacagatctgcaatggcaggggcatctgtgagtgtggcgcctgtaagtgt
acagatccgaagtttcaagggccaacttgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcgcacaggaatgttcacatttcaacattaccaaggttgaaaatcgagacaaattacca
cagccaggccaggtcgatcccctgtcccattgtaaggagaaagatgttgatgattgctgg
ttttatttcacgtattcagtgaatgggaacaatgaggccattgttcatgttgtagagact
ccagagtgccccactggtccagacatcattccaattgtagctggcgtggttgctggaatt
gttcttattggccttgcattactgcttatttggaagcttttaatgataattcatgacaca
agggaatttgccaaatttgaaaaggaaaagatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtgacaactgttgtcaatccgaaatatgagggaaaatga

DBGET integrated database retrieval system