KEGG   Felis catus (domestic cat): 101093069
Entry
101093069         CDS       T02385                                 
Symbol
NUDT16L1
Name
(RefSeq) tudor-interacting repair regulator protein
  KO
K16867  NUDT16-like protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101093069 (NUDT16L1)
SSDB
Other DBs
NCBI-GeneID: 101093069
NCBI-ProteinID: XP_006942437
Ensembl: ENSFCAG00000004563
LinkDB
Position
E3:complement(40671610..40674351)
AA seq 210 aa
MSAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLG
FPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQ
LHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFTSTAKYQLLFALKVLN
MMPEEKLAEALAAATEKQKKALEKLLPSSS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtcggcggcagtgccggagctgaagcagatcagccgtgtggaagctatgcgcctgggg
ccgggctggagccactcgtgccacgccatgctgtacgccgccaaccccgggcagcttttc
ggccgcatccctatgcgcttctcggtgctgatgcagatgcgcttcgacgggctgctgggt
ttccccgggggcttcgtggaccggcggttttggtctctggaggacggtctgaaccgggtg
ctgggcctgggcctgggctgcctgcgcctcacggaggccgactacctgagctcgcacctg
accgagggcccgcaccgcgtcgtggcgcacctgtacgcacggcagctgacgctggagcag
ctgcacgccgtggaaatcagcgcggtgcattcgcgcgaccacggcctggaggtgctgggg
cttgtgcgggttccactttacacccaaaaggaccgagtcggtggctttcccaacttcctg
agcaacgcctttaccagcactgccaagtaccagctgctcttcgccctcaaggtgctcaac
atgatgcccgaggagaagctggctgaggctttggctgctgccacagagaagcagaagaaa
gccctggaaaagctcctcccatcttcctcctga

DBGET integrated database retrieval system