KEGG   Felis catus (domestic cat): 101093110
Entry
101093110         CDS       T02385                                 
Symbol
RASGRP1
Name
(RefSeq) RAS guanyl-releasing protein 1 isoform X1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04611  Platelet activation
fca04660  T cell receptor signaling pathway
fca05200  Pathways in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093110 (RASGRP1)
   04014 Ras signaling pathway
    101093110 (RASGRP1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101093110 (RASGRP1)
   04660 T cell receptor signaling pathway
    101093110 (RASGRP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093110 (RASGRP1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101093110 (RASGRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101093110 (RASGRP1)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   101093110 (RASGRP1)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 CENP-F_leu_zip bZIP_1 DivIC DUF5409
Other DBs
NCBI-GeneID: 101093110
NCBI-ProteinID: XP_019688251
LinkDB
Position
B3:66505492..66585828
AA seq 802 aa
MLPFFTLLLLIIMTIYLNIHSPSNLQHKLFIHYWNHFKREGLLFFKLFQWESSSLGHGQG
GLLPLHFIEATCAGIFQCCWLPTSPPAKDFSFFPQAISAWATWKVTTVTLPSPTYKDALA
KNSPGLCLKICYFVRYWITEFWIMFKMDASLTHTMEEFQELVKANGEELHRRLIDTTQIN
ARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVN
SCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLM
AVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTQFKIPIL
GVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHINELVQLQEVAPPLEANKDLVHLLTL
SLDLYYTEDEIYELSYAREPRNHKAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMV
DSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISREEITAYFMRASSIYSK
LGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRA
KNPAAITENSTPGGPTSSLCSLGAKDLLHAPEEGPFTFPNGEAVEHSEESKDRTIMLMGV
SSQKISVRLKRTVAHKATQTESPPWLGSERPCGPFVLSSPRKTAQDTLYVLPSPTSPCPS
PVLVRKRAFVKWENKESLIKSKEDLRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKK
IETLQLARSNHVLAQMEQGDCS
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgttaccatttttcacattactgcttttaattatcatgacaatatatctgaatattcat
tccccttctaacttacagcacaaattgtttatccattactggaatcactttaaaagagag
gggctcctcttttttaagttgtttcagtgggagtcctcatctcttgggcatgggcaagga
ggccttttgccccttcacttcatagaggccacctgtgctgggatctttcaatgctgttgg
cttcccacttctcctcctgcaaaggacttctccttctttccacaagccatttcagcgtgg
gctacatggaaggtcaccacagtcacccttccaagccctacctataaggatgccttggca
aagaattcgccagggctttgcctgaagatctgctattttgtaaggtactggataacagaa
ttctggatcatgtttaaaatggatgccagcttgacacacaccatggaggagttccaggaa
ctggtgaaggccaacggggaggagctacaccgccgtctgattgacacgacccagatcaat
gcccgtgactggtccaggaaactgactcaaaggataaaatcgaacaccagcaagaagcgt
aaagtctccctgctctttgaccacctggaaccagaagagttatccgagcacctcacgtac
cttgagttcaagtccttccggaggatatccttctccgattatcagaattaccttgtgaac
agctgcgtgaaggagaaccccaccatggagcggtccattgccctgtgtaacggcatctcc
cagtgggtacagctgatggttctcagccgccccaccccgcagctccgggcagaagtcttc
atcaagttcatccaggtggctcagaagctccaccagctacagaacttcaatacattgatg
gctgtgataggtgggctgtgtcacagctcaatctccaggctcaaggagacaagttcgcac
gtcccacatgaaatcaataaggttctaggggagatgaccgagctcctgtcctcctgtaga
aactatgacaactaccggcgagcctacggggagtgcacccaattcaagattcccatcctg
ggggtgcacctcaaggacctcatctccctgtacgaggccatgcccgattacctggaggat
gggaaggtgaacgtccacaagctgctggctctttataatcatatcaacgaactggtccag
ctgcaagaggtggccccacccctggaagccaacaaggacttggtgcacctgctgacgttg
tccttagatctctactacactgaagatgaaatctatgagctgtcctatgcccgggaacca
aggaaccacaaagccccaccactaacaccctcaaagcctccagtagtagtggactgggct
tctggagtatctcccaaacctgacccaaagaccataagcaaacacgtccagaggatggtg
gattcggtcttcaagaactatgatcatgaccaggatggatacatttctcaggaagagttt
gagaagattgccgccagtttccccttttccttctgtgtgatggacaaagacagggaaggc
ctcatcagcagagaggagataacggcctacttcatgagagccagctccatctactccaag
ctgggcctgggctttcctcacaacttccaagagaccacctacctgaaacctactttctgt
gacaactgtgctggatttctctggggagtgatcaaacaaggataccgatgtaaagactgc
gggatgaactgccacaaacaatgcaaagatctggttgtgtttgagtgcaagaagcgagcc
aagaacccagcagcaataaccgagaacagtacccctggagggccaacatccagcctttgc
tcactgggagccaaagacctgctccatgcacctgaggagggacctttcacattccctaat
ggagaggctgtggaacacagtgaggaaagtaaagatcggaccatcatgctcatgggagtg
tcctcacagaagatttctgttcggctgaagaggactgtcgcccacaaggccacccagacg
gaatccccgccttggcttggcagtgagcgtccctgtgggccctttgtgctctcttcccca
aggaagacagcccaggatactctgtatgtgcttcctagtcccacatctccttgccccagc
ccagtcttggtcagaaagcgggcttttgtcaagtgggagaataaagaatccctcataaaa
tcaaaggaggatctccgtcatctcagactgccaacctaccaagagctggaacaggaaata
aataccctgaaagcagataatgacgctctaaagatccaactgaaatatgcacagaagaaa
atagaaactctccaacttgcaagaagcaatcatgtcttagctcagatggagcagggtgac
tgttcttag

DBGET integrated database retrieval system