KEGG   Felis catus (domestic cat): 101093207
Entry
101093207         CDS       T02385                                 
Symbol
HSPB2
Name
(RefSeq) heat shock protein beta-2
  KO
K09543  heat shock protein beta-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101093207 (HSPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101093207 (HSPB2)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP20
   101093207 (HSPB2)
SSDB
Motif
Pfam: HSP20 Crystallin
Other DBs
NCBI-GeneID: 101093207
NCBI-ProteinID: XP_003992394
Ensembl: ENSFCAG00000015672
UniProt: A0A2I2UD88
LinkDB
Position
D1:9949327..9950758
AA seq 182 aa
MSGRSVPHAHPATTEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRATAAGEGS
RAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRT
YVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAGRV
EP
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaggccgctcggtgccacatgcccacccggccaccaccgagtacgaattcgccaac
cccagccgtctgggcgagcagcgcttcggagaaggcctcctgccagaagagatcctgacc
cccaccctctaccacggctactatgtgcggccccgggccaccgcagctggggagggcagc
agggcaggggcctcggagctcaggctcagtgagggtaaatttcaggcatttctggatgtg
agccacttcaccccagatgaggtgactgtaaggactgtggacaacctgctggaggtgtct
gccaggcacccccagcgcctggaccgccacggcttcgtgtcccgagagttctgccgcacc
tatgtcctgcctgctgacgtggacccctggcgggtccgcgcagctctctcccacgatggc
atccttaacctggaggcacctcggggtggccgccatttggacacggaggtcaacgaggtc
tacatctccctgctccctgcgcctccagatccagaggaagaggaggaggcaggcagagtg
gagccctga

DBGET integrated database retrieval system