KEGG   Felis catus (domestic cat): 101093319
Entry
101093319         CDS       T02385                                 
Symbol
LAT
Name
(RefSeq) linker for activation of T-cells family member 1 isoform X1
  KO
K07362  linker for activation of T cells
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04064  NF-kappa B signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05135  Yersinia infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101093319 (LAT)
   04015 Rap1 signaling pathway
    101093319 (LAT)
   04064 NF-kappa B signaling pathway
    101093319 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101093319 (LAT)
   04660 T cell receptor signaling pathway
    101093319 (LAT)
   04658 Th1 and Th2 cell differentiation
    101093319 (LAT)
   04659 Th17 cell differentiation
    101093319 (LAT)
   04664 Fc epsilon RI signaling pathway
    101093319 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    101093319 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101093319 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101093319 (LAT)
SSDB
Motif
Pfam: LAT LAX
Other DBs
NCBI-GeneID: 101093319
NCBI-ProteinID: XP_006942273
Ensembl: ENSFCAG00000018238
LinkDB
Position
E3:22100201..22105777
AA seq 289 aa
MISCPRPGSPQLPATGGQALRRSRRLAERQMEAVVLIPYVLGLLLLPLLAVVLCVRCREL
PGSYDNTASDSLAPSSIVIKRPPTLATWTPATSYPPVTSYPPLSQPDLLPIPRSPQPPGG
SHRMPSSRQDSDGANSVASYENEGASGAPGALVAGRLGPGLGPADRCVVTSEPACEDDDE
DEEEDYPNEGYLEVLPDSTPATGTAVPPAPAPSNPGLRDSAFSMESGEDYVNVPESEESA
DVSLDGSREYVNVSQELPPVARTEPAILSSQNDDEEEGAPDYENLQGLN
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatttcctgccctcgcccgggctcaccacagcttcctgccacaggcgggcaggcgctg
aggagaagcaggcgcctagccgagcggcagatggaggcggtcgtcctgatcccctacgtg
ctgggcctcctgctgctgccgctgctggctgtggtgctgtgcgtgcggtgccgagagctg
ccaggctcctatgacaatacggcctctgacagcttggccccaagtagcatcgtgatcaaa
cgccctcccacactcgccacctggacaccagccacctcctatcctcctgttacctcctac
ccacccttgagccagccggacctgcttcccatcccgaggtccccacagccccccgggggc
tcccaccgcatgccatcttcccggcaggactcagatggtgccaacagtgtggcgagctac
gagaacgagggtgcgtctggggccccaggtgccctggttgcagggaggctggggcctggg
ctgggccctgctgatcgctgtgtcgttacctcagagcccgcctgtgaggacgacgatgaa
gatgaggaggaggattatcccaacgagggctacttggaggtgcttcctgacagcacgcca
gcaacaggcactgctgtcccaccggctcccgcgcccagcaaccccggcctccgagacagc
gccttctccatggagtcgggggaggattacgtgaacgtccccgagagcgaggagagtgca
gacgtgtctctggatgggagccgggagtacgtgaatgtgtcccaggagctgccacccgtg
gctaggaccgagcctgccatcctgagctcccagaacgacgacgaggaagagggagctcca
gattatgagaatctgcaggggcttaactga

DBGET integrated database retrieval system