KEGG   Felis catus (domestic cat): 101093414
Entry
101093414         CDS       T02385                                 
Symbol
TGFB2
Name
(RefSeq) transforming growth factor beta-2 isoform X2
  KO
K13376  transforming growth factor beta-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04380  Osteoclast differentiation
fca04390  Hippo signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05410  Hypertrophic cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093414 (TGFB2)
   04350 TGF-beta signaling pathway
    101093414 (TGFB2)
   04390 Hippo signaling pathway
    101093414 (TGFB2)
   04068 FoxO signaling pathway
    101093414 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101093414 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101093414 (TGFB2)
   04218 Cellular senescence
    101093414 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101093414 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093414 (TGFB2)
   05206 MicroRNAs in cancer
    101093414 (TGFB2)
   05205 Proteoglycans in cancer
    101093414 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101093414 (TGFB2)
   05212 Pancreatic cancer
    101093414 (TGFB2)
   05225 Hepatocellular carcinoma
    101093414 (TGFB2)
   05226 Gastric cancer
    101093414 (TGFB2)
   05220 Chronic myeloid leukemia
    101093414 (TGFB2)
   05211 Renal cell carcinoma
    101093414 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093414 (TGFB2)
   05161 Hepatitis B
    101093414 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101093414 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101093414 (TGFB2)
   05144 Malaria
    101093414 (TGFB2)
   05145 Toxoplasmosis
    101093414 (TGFB2)
   05140 Leishmaniasis
    101093414 (TGFB2)
   05142 Chagas disease
    101093414 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101093414 (TGFB2)
   05321 Inflammatory bowel disease
    101093414 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101093414 (TGFB2)
   05414 Dilated cardiomyopathy
    101093414 (TGFB2)
   05415 Diabetic cardiomyopathy
    101093414 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101093414 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101093414 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101093414 (TGFB2)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101093414 (TGFB2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101093414 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 101093414
NCBI-ProteinID: XP_003999555
Ensembl: ENSFCAG00000003738
UniProt: A0A2I2U200
LinkDB
Position
F1:57902872..57986097
AA seq 414 aa
MHYCVLSAFLLLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgctcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcccgagccc
gaggaagtccccccggaggtgatttccatctacaacagcacccgggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgccc
actttctacagaccttacttcagaattgtccgatttgacgtctcagcgatggagaagaat
gcatccaatttggtgaaagccgagttcagagtctttcgtttacagaacccgaaggccaga
gtgcccgaacaaaggatcgaactgtatcagattctcaaatccaaagacttaacgtctcca
acccagcgctacattgacagcaaagtcgtgaagacaagggcagaaggcgaatggctttcc
ttcgatgtaactgacgccgttcacgaatggctccaccataaagacagaaacctgggattt
aaaataagcttacactgtccctgctgcacctttgtgccatctaataattacatcattccc
aataaaagtgaagagctagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtggaaagaccccacac
ctcctgctaatgttgttgccctcctacagacttgagtcacaacagtccaaccggcggaag
aagcgtgctttggatgcagcctattgttttagaaatgtgcaggataattgctgcctacgt
ccactttatattgatttcaagagggatcttgggtggaaatggattcatgaacctaaaggg
tacaatgccaacttctgtgctggagcttgcccgtatttatggagttcagacactcagcac
agtagggttctcagcttatataacaccataaatccagaagcatctgcttctccgtgctgt
gtgtcccaggatttagaaccgctaaccattctctactatatcggcaaaacacccaagatt
gaacagctttcaaatatgattgtaaagtcttgcaaatgcagctaa

KEGG   Felis catus (domestic cat): 101098469
Entry
101098469         CDS       T02385                                 
Symbol
TGFB3
Name
(RefSeq) transforming growth factor beta-3 isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04390  Hippo signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05410  Hypertrophic cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101098469 (TGFB3)
   04350 TGF-beta signaling pathway
    101098469 (TGFB3)
   04390 Hippo signaling pathway
    101098469 (TGFB3)
   04068 FoxO signaling pathway
    101098469 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101098469 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101098469 (TGFB3)
   04218 Cellular senescence
    101098469 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098469 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101098469 (TGFB3)
   05212 Pancreatic cancer
    101098469 (TGFB3)
   05225 Hepatocellular carcinoma
    101098469 (TGFB3)
   05226 Gastric cancer
    101098469 (TGFB3)
   05220 Chronic myeloid leukemia
    101098469 (TGFB3)
   05211 Renal cell carcinoma
    101098469 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098469 (TGFB3)
   05161 Hepatitis B
    101098469 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098469 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101098469 (TGFB3)
   05144 Malaria
    101098469 (TGFB3)
   05145 Toxoplasmosis
    101098469 (TGFB3)
   05140 Leishmaniasis
    101098469 (TGFB3)
   05142 Chagas disease
    101098469 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101098469 (TGFB3)
   05321 Inflammatory bowel disease
    101098469 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101098469 (TGFB3)
   05414 Dilated cardiomyopathy
    101098469 (TGFB3)
   05415 Diabetic cardiomyopathy
    101098469 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101098469 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101098469 (TGFB3)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101098469 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 101098469
NCBI-ProteinID: XP_003987900
Ensembl: ENSFCAG00000014204
UniProt: M3WKA2
LinkDB
Position
B3:complement(123200999..123223746)
AA seq 412 aa
MKMHLHRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcacagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagtccccccgagccatcg
gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctg
gccgtctgccccaaagggatcacctccaaggtcttccgcttcaacgtgtcctcagtggag
aaaaatggaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcgcagtgagcagaggatcgagctcttccagatactccggcccgatgagcacatc
gccaaacagcgctatatcggtggcaaaaatctgcccacacggggcaccgccgaatggctg
tctttcgacgtcactgacaccgtgcgggaatggctcttgcgaagagagtccaacttaggt
ctggaaatcagcattcactgtccgtgtcacacctttcagcccaatggagacatcttggaa
aacattcatgaggtgatggaaatcaaattcaaaggtgtggacagcgaggatgatcatggc
cgtggggatctcgggcgcctcaagaagcagaaggaccaccacaaccctcacctcatcctc
atgatgatccccccgcaccggctggacaacccgggccagggcgggcagaggaagaagcgg
gccctggacaccaactactgcttccgcaatttggaggagaactgctgtgtgcgccctctc
tacattgacttccgacaagatctgggctggaaatgggtccacgaacctaagggctactat
gccaacttctgctcaggcccctgcccctacctccgcagtgcggacacaacccacagcacg
gtgctgggactgtacaacaccctgaatcctgaagcctctgcctcaccttgctgtgtgccc
caggacttggagcccctgaccatcctgtactatgtcgggaggacccccaaggtggaacag
ctctctaacatggtggtcaagtcctgtaagtgtagctga

KEGG   Felis catus (domestic cat): 768263
Entry
768263            CDS       T02385                                 
Symbol
TGFB1
Name
(RefSeq) transforming growth factor beta-1 isoform X2
  KO
K13375  transforming growth factor beta-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04380  Osteoclast differentiation
fca04390  Hippo signaling pathway
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04926  Relaxin signaling pathway
fca04932  Non-alcoholic fatty liver disease
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05410  Hypertrophic cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    768263 (TGFB1)
   04350 TGF-beta signaling pathway
    768263 (TGFB1)
   04390 Hippo signaling pathway
    768263 (TGFB1)
   04068 FoxO signaling pathway
    768263 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    768263 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    768263 (TGFB1)
   04218 Cellular senescence
    768263 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    768263 (TGFB1)
   04672 Intestinal immune network for IgA production
    768263 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    768263 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    768263 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    768263 (TGFB1)
   05205 Proteoglycans in cancer
    768263 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    768263 (TGFB1)
   05212 Pancreatic cancer
    768263 (TGFB1)
   05225 Hepatocellular carcinoma
    768263 (TGFB1)
   05226 Gastric cancer
    768263 (TGFB1)
   05220 Chronic myeloid leukemia
    768263 (TGFB1)
   05211 Renal cell carcinoma
    768263 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    768263 (TGFB1)
   05161 Hepatitis B
    768263 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    768263 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    768263 (TGFB1)
   05144 Malaria
    768263 (TGFB1)
   05145 Toxoplasmosis
    768263 (TGFB1)
   05140 Leishmaniasis
    768263 (TGFB1)
   05142 Chagas disease
    768263 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    768263 (TGFB1)
   05321 Inflammatory bowel disease
    768263 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    768263 (TGFB1)
   05414 Dilated cardiomyopathy
    768263 (TGFB1)
   05415 Diabetic cardiomyopathy
    768263 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    768263 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    768263 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    768263 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    768263 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    768263 (TGFB1)
Chaperones and folding catalysts [BR:fca03110]
 Intramolecular chaperones
  Others
   768263 (TGFB1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   768263 (TGFB1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   768263 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 768263
NCBI-ProteinID: XP_003997823
Ensembl: ENSFCAG00000005436
UniProt: M3W421
LinkDB
Position
E2:13682375..13696674
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENTNKI
YEKVQRTPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNNSWR
YLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINGFS
SSRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgacgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggaactg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggctgtgctggccctt
tacaacagtacccgcgaccgggtggcgggggagagcgccgagccggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacaaaatc
tatgagaaagtccagcgtaccccgcacagcatatatatgctctttaacacgtcggagctc
cgagaagcagtgcccgagcccgtcttgctctcccgggcagagttgcgcctgctgaggctc
aagttaaaagcggagcagcacgtggagctgtaccagaaatacagcaataattcctggcgc
tacctcagcaaccggctgctggcgcccagtgacacgccggaatggctgtcctttgatgtc
actggagtggtgcggcagtggctgagccatggaggggaagtagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactgcaagtggacatcaacgggttcagt
tccagccgccgaggtgacctggccaccattcatggcatgaaccggccttttctgctcctc
atggccaccccgctggagagggcccagcacctgcacagctcgcggcaccgccgagccctg
gacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctctatatt
gacttccgcaaggatctgggctggaagtggatccacgagcccaagggctaccacgccaac
ttctgcctagggccctgtccctacatctggagcctggacacgcagtacagtaaggtcctg
gccctgtacaaccagcacaacccgggcgcgtcggcggctccctgctgcgtgccgcaggcg
ctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system