KEGG   Felis catus (domestic cat): 101093783
Entry
101093783         CDS       T02385                                 
Symbol
RAB5B
Name
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
fca05146  Amoebiasis
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101093783 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101093783 (RAB5B)
   04145 Phagosome
    101093783 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101093783 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101093783 (RAB5B)
   05152 Tuberculosis
    101093783 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101093783 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093783 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093783 (RAB5B)
   04031 GTP-binding proteins [BR:fca04031]
    101093783 (RAB5B)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    101093783 (RAB5B)
 Endosome - Lysosome transport
    101093783 (RAB5B)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101093783 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   101093783 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   101093783 (RAB5B)
  Exosomal proteins of melanoma cells
   101093783 (RAB5B)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    101093783 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 101093783
NCBI-ProteinID: XP_003988919
Ensembl: ENSFCAG00000013974
UniProt: M3WJU7
LinkDB
Position
B4:84609916..84625878
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag
ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagtctggtattacgtttt
gtcaaagggcagtttcatgagtaccaagagagcaccattggagcggccttcctcacccag
tctgtttgtctagatgacacaacagtcaagtttgagatttgggacacagctgggcaggag
cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat
gacattactaatcaggaaaccttcgcccgggcgaagacatgggtaaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaataag
cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg
gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag
ctgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat
ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Felis catus (domestic cat): 101094966
Entry
101094966         CDS       T02385                                 
Symbol
RAB5C
Name
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
fca05146  Amoebiasis
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101094966 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101094966 (RAB5C)
   04145 Phagosome
    101094966 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101094966 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101094966 (RAB5C)
   05152 Tuberculosis
    101094966 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101094966 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094966 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094966 (RAB5C)
   04031 GTP-binding proteins [BR:fca04031]
    101094966 (RAB5C)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    101094966 (RAB5C)
 Endosome - Lysosome transport
    101094966 (RAB5C)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101094966 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   101094966 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   101094966 (RAB5C)
  Exosomal proteins of bladder cancer cells
   101094966 (RAB5C)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    101094966 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 101094966
NCBI-ProteinID: XP_003996927
Ensembl: ENSFCAG00000002148
UniProt: M3VXZ7
LinkDB
Position
E1:complement(42778617..42801439)
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggtgcagcgcgacccaacggaccagccgctgggaacaagatctgt
cagtttaagctggtcctgctcggggagtctgcagtgggcaaatccagcctcgtgctccgc
tttgtcaagggacagttccatgagtaccaggagagcaccattggagcggccttcctcaca
cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaagctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggctagccccaacatcgtcatcgcacttgcagggaacaaggcggacctggccagc
aagagagccgtggagttccaggaagcacaagcctatgcggaagacaacagtctgctgttc
atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcagctggtgctccaggccggaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

KEGG   Felis catus (domestic cat): 101099995
Entry
101099995         CDS       T02385                                 
Symbol
RAB5A
Name
(RefSeq) ras-related protein Rab-5A
  KO
K07887  Ras-related protein Rab-5A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05132  Salmonella infection
fca05146  Amoebiasis
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101099995 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101099995 (RAB5A)
   04145 Phagosome
    101099995 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101099995 (RAB5A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101099995 (RAB5A)
   05152 Tuberculosis
    101099995 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101099995 (RAB5A)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101099995 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    101099995 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101099995 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101099995 (RAB5A)
   04031 GTP-binding proteins [BR:fca04031]
    101099995 (RAB5A)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    101099995 (RAB5A)
 Endosome - Lysosome transport
    101099995 (RAB5A)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101099995 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   101099995 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   101099995 (RAB5A)
  Exosomal proteins of bladder cancer cells
   101099995 (RAB5A)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    101099995 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 101099995
NCBI-ProteinID: XP_003992206
Ensembl: ENSFCAG00000004455
LinkDB
Position
C2:139043305..139073973
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt
gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa
actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg
caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa
agagctgtcgatttccaggaagcacagtcttatgcagatgacaacagtttattattcatg
gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag
ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac
cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system