KEGG   Felis catus (domestic cat): 101093902
Entry
101093902         CDS       T02385                                 
Symbol
DLG4
Name
(RefSeq) disks large homolog 4 isoform X10
  KO
K11828  discs large protein 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04390  Hippo signaling pathway
fca04724  Glutamatergic synapse
fca05016  Huntington disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101093902 (DLG4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101093902 (DLG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101093902 (DLG4)
   05022 Pathways of neurodegeneration - multiple diseases
    101093902 (DLG4)
  09165 Substance dependence
   05030 Cocaine addiction
    101093902 (DLG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093902 (DLG4)
Membrane trafficking [BR:fca04131]
 SNARE
  SNARE associated proteins
   Others
    101093902 (DLG4)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    101093902 (DLG4)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_6 PDZ_2 MAGUK_N_PEST SH3_1 Peptidase_M50 SH3_2 DUF6288 SH3_9
Other DBs
NCBI-GeneID: 101093902
NCBI-ProteinID: XP_011287185
Ensembl: ENSFCAG00000002824
LinkDB
Position
E1:complement(2158225..2181425)
AA seq 724 aa
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE
MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV
NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKLMEIKLIKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY
LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD
LLGEEDVPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRSASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVLDASDEEWWQARRVHPDS
EADDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL
GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE
AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE
INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA
RERL
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggactgtctctgtatagtgacaaccaagaaataccgctaccaagatgaagacacgccc
cctctggagcacagcccggcccacctccccaaccaggccaattctcctcctgtgattgtc
aacacagacaccctagaagccccgggatatgagttgcaggtgaacgggacggagggggaa
atggaatacgaggagatcacattggaaaggggcaactcaggtctgggcttcagcatcgca
ggcggcaccgacaacccacacattggtgacgacccgtccatcttcatcaccaagatcatt
cctggcggggccgcggcccaggacggccgcctcagggtcaacgatagcatcttgtttgtg
aatgaggtggacgtgcgggaggtgacccactcagccgcggtggaggccctcaaggaggcg
ggctccatcgtccgcctctacgtcatgcggcggaagcctccagctgagaagcttatggag
atcaaactcatcaaggggcctaaaggtcttggcttcagcatcgcggggggcgtagggaac
caacacatccccggagataacagcatctacgtgacaaagatcatcgaagggggtgccgcc
cacaaggacgggaggctgcagattggggacaagattctagcggtcaacagtgtggggctg
gaggacgtcatgcatgaggacgccgtggcagccctgaagaacacatatgacgttgtctac
ctgaaggtggccaagcccagcaatgcctacctgagtgacagctatgctcccccagacatc
acaacctcttattcccagcacctggacaacgagattagtcacagcagctacctgggtacc
gactaccccacagccatgacccccacctcccctcggcgttactccccggtggccaaggac
ctgctgggggaggaagacgttccccgggaaccgaggcgcatagtgatccaccggggctcc
acgggcctgggcttcaacattgtgggtggcgaggacggtgagggcatctttatctccttc
atcctggccggtggccctgcggacctcagcggggagctgcggaagggggaccagatcctc
tcggtgaatggtgttgacctccgcagtgccagccacgagcaggctgccatcgccttgaag
aacgcgggccagacggtcaccatcatcgctcagtataaaccagaagagtacagccgattc
gaggccaagatccacgaccttcgggaacagctcatgaacagcagcctgggctcagggacc
gcctccctgcggagcaaccccaaaaggggtttctacatcagggccctgtttgattacgac
aagaccaaggactgtggcttcctgagccaggccctgagcttccgttttggggacgtgctg
cacgtgctcgacgccagtgacgaggagtggtggcaggcacggcgggtccaccccgacagc
gaggccgatgacatcggcttcatccccagcaaacggcgggtcgaacgacgggagtggtca
aggttaaaggccaaggattggggctccagctctggatcacagggtcgagaagactccgtt
ctgagctatgagacggtgacgcagatggaagtgcactatgctcgccccatcatcatcctt
gggcccaccaaggaccgagccaatgatgaccttctgtccgagttccccgacaagttcgga
tcctgtgttccccatacgacgcggcccaagcgggaatatgagatagatggccgggattac
cacttcgtgtcctcccgggaaaaaatggagaaggacattcaggcgcacaagttcatcgag
gccggccagtacaacagccacctatacggaacgagcgtccagtccgtgcgagaggtggcc
gagcaggggaagcactgcatcctcgatgtctcggccaatgccgtgcggcggctgcaggcg
gcccacctgcaccccatcgccatcttcattcgcccccgctccctggagaatgtgctagag
attaataagcggatcacagaggaacaagctcgcaaagccttcgacagagccaccaagctg
gagcaggaattcacagagtgcttctcagccatcgtggagggcgacagctttgaggagatc
taccacaaggtgaagcgtgtcatcgaggacctctcaggcccctacatctgggtcccggcc
cgagagagactctga

DBGET integrated database retrieval system