KEGG   Felis catus (domestic cat): 101094007
Entry
101094007         CDS       T02385                                 
Symbol
TWIST1
Name
(RefSeq) twist-related protein 1
  KO
K09069  twist
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101094007 (TWIST1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101094007 (TWIST1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    101094007 (TWIST1)
SSDB
Motif
Pfam: HLH HTH_51 CDK5RAP3 GDH_N
Other DBs
NCBI-GeneID: 101094007
NCBI-ProteinID: XP_003982906
LinkDB
Position
A2:complement(113452909..113454730)
AA seq 200 aa
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGGGGGGAGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQ
SLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHER
LSYAFSVWRMEGAWSMSASH
NT seq 603 nt   +upstreamnt  +downstreamnt
atgatgcaggacgtgtccagctcgccagtctcgccggccgacgacagcctgagcaacagc
gaggaagagccggaccggcagcagccgccgagcggcaagcgcggggggcgcaagcggcgc
agcagccggcgcagcgcgggcggcggcgcggggcccggcggggccgcgggcgggggcgtc
ggaggcggcgacgagccgggcagcccggcccagggcaagcgcggcaagaaatctgcgggt
ggcggcggcggcggcgccggcggcggcggcagcagcagcggcggcgggagcccgcagtcc
tacgaggagctgcagacgcagcgggtcatggccaacgtgcgggagcgccagcgcacgcaa
tcgctgaacgaggcgttcgccgcgctgcggaagatcatccccacgctgccttcggacaag
ctgagcaagatccagaccctcaagttggcggccaggtacatcgacttcctctaccaggtt
ctccagagcgacgagctggactccaagatggcaagctgcagctatgtggcccatgagcgg
ctcagctacgccttctcggtctggaggatggagggggcctggtccatgtccgcgtcccac
tag

KEGG   Felis catus (domestic cat): 109502970
Entry
109502970         CDS       T02385                                 
Symbol
TWIST2
Name
(RefSeq) twist-related protein 2
  KO
K09069  twist
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109502970 (TWIST2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    109502970 (TWIST2)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    109502970 (TWIST2)
SSDB
Motif
Pfam: HLH HTH_51 CDK5RAP3 GDH_N
Other DBs
NCBI-GeneID: 109502970
NCBI-ProteinID: XP_023115703
LinkDB
Position
C1:220474264..220523649
AA seq 160 aa
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGRKGSPSAQS
FEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV
LQSDEMDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
NT seq 483 nt   +upstreamnt  +downstreamnt
atggaggagggctccagctcgcccgtgtcccccgtggacagcctgggcaccagcgaggag
gagctcgagaggcagcccaagcgcttcggccggaagcggcgctacagcaagaagtcgagc
gaagatggcagcccgaccccgggcaagcgcggcaggaagggcagcccgagcgcgcagtcc
ttcgaggagctgcagagccagcgcatcctggccaacgtgcgcgagcgccagcgcacccag
tcgctgaacgaggccttcgcggcgctgcgcaagatcatccccacgctgccctcggacaag
ctcagcaagatccagacgctcaagctggccgccaggtacatagacttcctctaccaggtc
ctgcagagcgacgagatggacagtaagatggccagctgcagctacgtggcccacgagcgc
ctcagctacgccttctccgtgtggcgcatggagggcgcgtggtccatgtcggcctcccac
tag

DBGET integrated database retrieval system