KEGG   Felis catus (domestic cat): 101094096
Entry
101094096         CDS       T02385                                 
Name
(RefSeq) platelet factor 4-like
  KO
K05407  platelet factor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094096
   04061 Viral protein interaction with cytokine and cytokine receptor
    101094096
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101094096
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094096
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101094096
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101094096
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101094096
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101094096
NCBI-ProteinID: XP_011280030
UniProt: A0A337SE00
LinkDB
Position
B1:complement(148024169..148025159)
AA seq 104 aa
MRLRVGAGAPRPLPSSGLLLLGLLLLPAVVALPRVDPEDEHLRCVCVKTTSEVRPKHIRS
LEVMGATVHCPVPQMIASLKNGRKICLDLNAPLYKKILRKLLES
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaggcttcgagtgggtgccggcgcccccaggcccctgcccagctcggggctcctgctc
ctgggactgctgctcttgccagctgtggtcgccctccccagagtggacccagaagatgag
cacctgcgctgcgtgtgcgtgaagaccacctccgaagtccgtcccaagcatatccgcagc
ctggaggtgatgggtgcgacagtccactgccccgttccccagatgatagcttctctgaag
aatggtaggaaaatatgcctggacctgaacgcccccctgtataagaaaatactccggaag
cttttggagagctag

KEGG   Felis catus (domestic cat): 101096888
Entry
101096888         CDS       T02385                                 
Symbol
CXCL13
Name
(RefSeq) C-X-C motif chemokine 13
  KO
K10032  C-X-C motif chemokine 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096888 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096888 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101096888 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096888 (CXCL13)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101096888 (CXCL13)
SSDB
Motif
Pfam: IL8 IRK
Other DBs
NCBI-GeneID: 101096888
NCBI-ProteinID: XP_003985309
UniProt: A0A2I2U3A5
LinkDB
Position
B1:complement(144698048..144704238)
AA seq 100 aa
MRFSLGFLLLMLLVYSITPVHGVLEAFNTNLKCKCVQETSAFIPIQLIEKLQVLPPGNGC
PNKEIIVWKKNKSVVCLNPQAKWILKLIKMLQRKSAVSTP
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaggttctccctgggatttctgcttctcatgctgttggtctacagcatcactccagtc
catggtgttctggaggcctttaacacaaacttaaagtgtaaatgcgtccaagagacctca
gcctttatccccatccaactcattgaaaagcttcaggtcttgcctcctgggaatgggtgc
ccaaacaaagaaatcatagtttggaagaagaataagtcagttgtatgcttgaaccctcaa
gctaaatggatactaaaattaataaaaatgttacagagaaaaagtgctgtttcaactcca
tga

KEGG   Felis catus (domestic cat): 101099880
Entry
101099880         CDS       T02385                                 
Symbol
CXCL11
Name
(RefSeq) C-X-C motif chemokine 11
  KO
K12672  C-X-C motif chemokine 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099880 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099880 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101099880 (CXCL11)
   04062 Chemokine signaling pathway
    101099880 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101099880 (CXCL11)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101099880 (CXCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101099880
NCBI-ProteinID: XP_023108805
Ensembl: ENSFCAG00000023938
LinkDB
Position
B1:146137267..146139246
AA seq 100 aa
MSVKGMVIVLAVIFCATIVQGFPMFKGGRCLCIGPGVKAVKVADIEKATIIYPSNNCNKI
EVIITLKAHKGQRCLNPKSKQANIIIKKIKRMNFLKYQDV
NT seq 303 nt   +upstreamnt  +downstreamnt
atgagtgtgaagggcatggttatagtcttggctgtgatattctgtgctacaattgttcaa
ggtttccccatgttcaaagggggacgctgtctttgcataggccctggagtaaaagcagtg
aaagtggcagatattgagaaagccaccataatttacccaagtaacaactgtaacaaaata
gaagtgattatcaccttgaaagcacataaaggacaaagatgcctaaatcccaaatcgaag
caagcaaacattataatcaagaaaattaaaagaatgaattttttaaaatatcaagatgta
tga

KEGG   Felis catus (domestic cat): 101100131
Entry
101100131         CDS       T02385                                 
Symbol
CXCL10
Name
(RefSeq) C-X-C motif chemokine 10
  KO
K12671  C-X-C motif chemokine 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05160  Hepatitis C
fca05164  Influenza A
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101100131 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100131 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100131 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100131 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    101100131 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    101100131 (CXCL10)
   04657 IL-17 signaling pathway
    101100131 (CXCL10)
   04062 Chemokine signaling pathway
    101100131 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101100131 (CXCL10)
   05171 Coronavirus disease - COVID-19
    101100131 (CXCL10)
   05164 Influenza A
    101100131 (CXCL10)
   05169 Epstein-Barr virus infection
    101100131 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101100131 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101100131 (CXCL10)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101100131 (CXCL10)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101100131 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101100131
NCBI-ProteinID: XP_003985323
UniProt: A0A2I2UFH1
LinkDB
Position
B1:146169700..146171976
AA seq 98 aa
MNQRAVLIFCLIFLTLSGIQGIPLSRTPRCTCIKISELSVNLRSLEKLEVIPASHFCPRV
EIIATMKKNGEKTCLNPESKTIKNLVKAISKERSKRSP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaccaacgagctgttcttattttctgtcttatctttctgactctgagtggaattcaa
ggaatacctctctctagaacaccacgctgtacctgtatcaagattagtgaactatctgta
aatctaaggtccttagaaaaacttgaagtgattcctgcaagtcacttttgtccacgtgtt
gaaatcattgctacaatgaaaaagaatggggagaaaacatgcctgaatccagagtctaag
accatcaagaatttagtgaaagcaattagcaaggaaaggtctaaaagatctccttga

KEGG   Felis catus (domestic cat): 101100388
Entry
101100388         CDS       T02385                                 
Symbol
CXCL9
Name
(RefSeq) C-X-C motif chemokine 9
  KO
K05416  C-X-C motif chemokine 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100388 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100388 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100388 (CXCL9)
   04062 Chemokine signaling pathway
    101100388 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101100388 (CXCL9)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101100388 (CXCL9)
SSDB
Motif
Pfam: IL8 Rtf2
Other DBs
NCBI-GeneID: 101100388
NCBI-ProteinID: XP_003985324
Ensembl: ENSFCAG00000008365
LinkDB
Position
B1:146196205..146202668
AA seq 126 aa
MKKSGIPLLLSIIFLTLLGGQGTLIMRNRRCFCINTSQGTIHLKSLKDLKQFAPSPSCEK
TEIIVTMKNGDQTCLNPDSADVQELIKEWEKQVSQKKKQKKGKKNQKSRKIFKVKKSQHP
HQKKTT
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaagaaaagtggtattcctcttttgttgagtatcatcttcctgactctgcttggcggt
caaggaaccctaataatgaggaatagacgctgtttctgcatcaacaccagccaagggaca
atccacctaaaatccttaaaggaccttaaacaatttgccccaagcccttcttgtgagaaa
actgaaatcattgtgacaatgaagaatggggatcaaacgtgtctaaacccagattcagca
gatgtgcaagaattgattaaagagtgggagaaacaggtgagccaaaagaaaaagcaaaaa
aaagggaaaaaaaatcaaaaaagcaggaaaatttttaaagttaaaaaatctcaacatcct
catcaaaagaagaccacatga

DBGET integrated database retrieval system