KEGG   Felis catus (domestic cat): 101094133
Entry
101094133         CDS       T02385                                 
Symbol
LSP1
Name
(RefSeq) lymphocyte-specific protein 1 isoform X5
  KO
K14957  lymphocyte-specific protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101094133 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101094133 (LSP1)
SSDB
Motif
Pfam: Caldesmon
Other DBs
NCBI-GeneID: 101094133
NCBI-ProteinID: XP_006937710
Ensembl: ENSFCAG00000022445
UniProt: A0A5F5XE66
LinkDB
Position
D1:complement(116133416..116171621)
AA seq 363 aa
MAEAPSHPGSEEQEALLVDKDAGLTTQRSAEDEEEAARERRRRARDRELRAQDEDGGQSP
EPPERESLLSLKPSEAPELDEDEGFSDWSQKPEPQRQPWEAGGASNSGEPPRSESPEGQQ
EENRPHQHAYGSQGGDEQSPARVSLEELHLSPSSELQDGPETEETEPKSPEGTVQGSLGP
AEAEEADEQHQKRQQPRTPSPLVSEGATEQGSPPLSPSTKLIDRTESLNRSIRKSNSVKK
SQPALPISKIDERLEQYTQAIETAGRTPKLTRQPSIELPSMAVASTKSRWETGEVQAQST
AKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKQSTPSGKRYKFVATGHGKYEKVLVDEG
SVP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcagaggctccaagccaccctggctccgaggagcaggaggcgctactggtggacaaa
gacgccgggctcacgactcagcggagcgcggaagatgaggaggaggccgcccgcgagcgt
cgccgccgggcgagggacagggagcttcgggcccaggacgaggacggcggccagtcccca
gagccgccggagcgggagagcctcctcagcctgaagccctcggaggcccctgaactggat
gaggacgagggtttcagcgactggtcccagaagccagagccacagcggcagccctgggag
gccgggggggcctccaacagcggggagccccctcggagcgagagtccggaggggcagcag
gaggagaacaggccccatcagcatgcctacgggagccagggtggtgatgagcagagtcca
gccagagtcagcctggaggagttgcatctgagccccagctcagagctccaggatgggccg
gaaacagaggagacagagcccaagagcccagaggggaccgtccagggcagcctggggccg
gcagaagccgaagaggcagacgagcagcaccagaaacgccagcagcccaggacgcccagc
cccctggtctcggagggtgctaccgaacagggctcacctcccctgagccccagcaccaaa
ctcatcgacagaactgagtccctgaaccgctccatcaggaagagtaacagtgtgaagaag
tcccaaccagccttgcccatctccaagattgatgagcgactggagcagtacacacaggcc
attgagactgctggccggacccccaagctaacccgccagccctccattgagctgcccagc
atggctgtggcgagcaccaagagccggtgggagacaggagaagtgcaggctcagtccact
gccaagaccccctcttgcaaggacatcgtagctggagacatgagcaagaaaagcctctgg
gagcaaaaaggaggctccaagacgtcatcgacaattaagcagagcactccgtctggaaag
aggtacaagtttgtggccaccggacatgggaagtatgagaaggtgcttgtggacgagggc
tcggtgccctag

DBGET integrated database retrieval system