KEGG   Felis catus (domestic cat): 101094530
Entry
101094530         CDS       T02385                                 
Symbol
TIAM1
Name
(RefSeq) T-lymphoma invasion and metastasis-inducing protein 1 isoform X1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04530  Tight junction
fca04810  Regulation of actin cytoskeleton
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101094530 (TIAM1)
   04015 Rap1 signaling pathway
    101094530 (TIAM1)
   04024 cAMP signaling pathway
    101094530 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101094530 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101094530 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101094530 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101094530 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101094530 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101094530 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_2 PDZ_6 PH_11 Peptidase_M50
Other DBs
NCBI-GeneID: 101094530
NCBI-ProteinID: XP_003991527
Ensembl: ENSFCAG00000002364
UniProt: M3VYD4
LinkDB
Position
C2:13671435..13986491
AA seq 1591 aa
MGNAESQNVEHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALEDFGSPIWVDRVDMGLRPVSYTDSSVAPSVDSSIVLTA
ASVQSMPDSEESRLYGDDAAYLADGGRRQHPYTSNGPAFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILVSTEEKDCEEARGMEPRASPRRLSACQRANSLGDLYAQKN
SGVTANGGPRSKFAGYCRNLVSDIPELANHKMPPAAAEDSVPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGS
DAVKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICP
KVTQNIQIEKSDTASDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINS
RAAGTLNSSVLKDFLTQPSLGLLVRTYPELVGGVELLDCPPHRADGPADLNDSPLAFLSS
NPGHGLCGEQGSGAETALEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNLSDPSPS
PQDSTGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSATLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERIFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGAAVDTDLPEQLQAASISQRERGRKSLDSHASRMTQLKKQAALS
GINGGLEGPSEEVIWVRREDFAPSRKLNTEI
NT seq 4776 nt   +upstreamnt  +downstreamnt
atgggaaacgcagagagtcaaaatgtagagcatgagttttatggagaaaagcatgccagc
ctgggccgcaagcacacgtcgcgctccctgcgcctgtcgcacaaggcgcggcggacgagg
cacgcgtcctcggggaaggtgatccacaggaactccgaagtgagcacgcggtccagcagc
acgcccagcatcccccagtctctggccgaaaatggcctggagcccttctcccaagaaggc
gccctggaggacttcggcagccccatctgggtggaccgagtggatatgggcctgagaccc
gtgtcgtacaccgactcttctgtcgctcccagcgtagacagcagcatcgtcctcacagcc
gcctctgtgcagagcatgccagactcggaggagagcaggctttacggggatgacgctgcg
tacttggctgacgggggcaggaggcagcatccctatacatccaatgggcccgctttcatg
gagacggcgagctttaagaagaagcgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctccgatctgagccaagaacatttaacaagcaacgaagaaatcttg
gtttccactgaagagaaagactgtgaggaggctcgggggatggaaccccgggcgagtccg
cggcggctcagcgcctgtcagcgtgccaattccctgggtgacttgtacgctcagaaaaac
tccggggtgacggcaaacggggggccaaggagcaaatttgcaggctactgtcggaatctg
gtgtctgatatccccgagcttgcaaaccataagatgccaccggctgctgctgaagactct
gttccttacagtaattacaacacactcccctgtaggaaatctcactgtctttccgaaggt
gccaccaacccacaaattagccatagcaacagcatgcaaggcagaagagcaaaaacaact
caggatgttaatgccggcgagggcagtgagtttgcggacagcgggatcgaaggggccacc
accgacacggacctcctgtccaggcgatccaatgccaccaactccagctactcgcccccc
accggccgcgcctttgtgggcagcgacagcggcagcagctccacgggggatgcggcccgc
cagggggtgtacgagaatttccggcgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggcgggctcggcgcacagcgacgagcagagcagcggcaccctgagctccccg
ggccagtcggacatcctgctcacggccgcgcagggcacggtgcgcaaggccggggcgctg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtggagtcggccacccggagg
aagtggaagcactactgggtgtccctgaaagggtgcacactcttcttctatgagagcgat
ggtaggtctggaatagaccacaacagcatccctaagcacgccgtgtgggtggagaacagc
atcgtgcaggctgtgcctgaacaccccaagaaggacttcgtcttctgcctcagcaattcc
ctgggtgatgctttcctctttcagaccaccagccagacggagctcgaaaactggatcacc
gccatccactctgcctgcgcggctgccgtggcgagacatcaccacaaagaggacacgctc
cggctcctgaagtccgagatcaaaaaactggaacagaagattgatatggatgagaagatg
aagaaaatgggcgaaatgcagctgtcttcggtcaccgattcgaagaagaagaagactata
ttagatcagatcttcgtttgggagcagaatctcgagcagttccaaatggacctgtttcgt
taccgctgttacttagctagcctccaaggtggggaactgccaaaccccaaaaggctactt
gcttttgcaagccgaccaacgaaagtggcaatgggccgccttggaatcttctctgtatca
tccttccatgccctggtggcagcacgcactggtgagaccggagtgagacgtcgtactcag
gccatgtccagatccgcaagcaagcgaaggagcaggttttcttccctttggggtctggac
actacctccaaaaagaagcagggacgccccagcatcaaccaggtgttcggtgagggaagt
gatgctgtaaagaaatctttagagggaatatttgatgacactgttccagatggcaagagg
gagaaagaaatggtcttgcccagcgtccaccagcacaatcccgactgtgacatttgggtc
cacgagtatttcacaccatcgtggttctgtctgccaaataatcagccagccctgacggtc
gtccggcccggggacactgcccgggacaccctggagctgatctgtaagacacatcaactg
gatcactctgctcattacctgcgtctgaaatttctaatagaaaacaaaatgcaacactac
gttccaaagcccgaggaggacatttatgagctgctgtacaaagaaattgaaatttgtcca
aaagtcactcagaacatccagattgagaagtcagatacagccagtgataattatggcttt
tccctttcctctgtggaagaagatggcgttcgaaggctctatgtgaatagtgtaaaggaa
actggcttagcttccaagaaaggcctgaaagcgggagatgagattctcgagatcaatagc
cgggctgcaggcaccctgaactcctctgtgctcaaagatttcctcacgcagccgtccctg
ggcctcctggtgaggacctaccccgagctggtcgggggtgtggagctgctggactgcccg
ccccaccgagcggacggccccgcggatctcaacgacagccccctggccttcctcagcagc
aacccagggcacggcctgtgcggcgagcagggcagtggtgctgagaccgctctggaggag
accgaagggccagacctggaatcctcagatgaaactgatcacagcagcaagagcacggaa
caggtggccgcattttgccgcagtctgcatgagatgaacctctctgacccgagcccatcg
cctcaggactccacggggcctcagctggccaccatgaggcagctcaccgacgctgacaag
ctgcgcaaggtcatctgtgagctcctggagacggagcgcacctatgtgaaagacttaaac
tgtctcatggagagataccttaaacctcttcaaaaagaaactttcctcacccaagatgag
ctggacgtgctcttcggaaacctcaccgaaatggtagagtttcaggtagaatttctgaaa
accctggaggatggagtaagactggtccctgatttggaaaagctcgagaaagtcgaccaa
tttaagaaagtgctgttctccctggggggatcctttctgtattacgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacgaaggtccccaaggtcctggtgaaagccaag
acggacacggctttcaaggcgttcttagatgcccagaacccgaaacagcagcactcagcc
actctcgagtcttacctcatcaagcccatccagaggatcctcaagtacccgcttctgctg
aaggagctctttgccctgacggatgccgagagcgaggagcactaccacctggacgtggcc
atcaagactatgaacaaggttgcaagtcatatcaatgaaatgcagaaaattcatgaagaa
tttggggctgtgtttgaccagctcattgctgaacagaccggtgagaaaaaagaggttgca
gatctgagcatgggggacctgcttttgcacaccaccgtgatttggccaaacccgccagcc
tccctgggaaagtggaaaaaggagccagaactggcagcctttgtcttcaaaactgctgtg
gtccttgtgtataaagacggttccaaacagaagaagaaacttgtaggatctcacaggctt
tcgatttatgaggactgggaccccttccggtttcggcacatgatccccaccgaagctctg
caggttcgagctttggcaagtgcagacgcggaagcaaatgccgtgtgtgaaattgtccat
gtaaagtctgagtctgaagggaggccggagaggatcttccacctgtgctgcagctctcca
gagagccggaaagatttcctgaaggctgtgcattcaatcctgcgtgataagcacagaaga
cagctcctcaaaactgaaagccttccctcatcccagcaatatgtaccttttggaggaaaa
agattgtgtgcgctcaaaggggccaggccagccatgagcagggcagtgtccgccccaagc
aagtctcttggcagaaggaggcggcgactggctcgaaacaggtttaccattgactctgat
gccatctcggccagcagcccggagaaagagtcccagcagccccccggtggcggggacact
gaccgatgggtagaggaacagttcgatcttgctcagtacgaggagcaagacgacatcaag
gagacagacatcctcagtgacgatgatgagttctgtgagtccgtgaagggcgccgcggtg
gacacagacctgcccgagcagcttcaggctgcgtccatcagtcagcgggagagaggccgc
aaaagcctggatagtcacgcgtcccgcatgacgcagctcaagaagcaagccgccctgtcg
ggcatcaatggaggcctggagggcccgagcgaggaagtcatctgggttaggcgcgaagac
tttgccccctccaggaaactgaacactgagatctga

DBGET integrated database retrieval system