KEGG   Felis catus (domestic cat): 101094569
Entry
101094569         CDS       T02385                                 
Symbol
ACKR1
Name
(RefSeq) atypical chemokine receptor 1
  KO
K06574  atypical chemokine receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101094569 (ACKR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101094569 (ACKR1)
   04050 Cytokine receptors [BR:fca04050]
    101094569 (ACKR1)
   04090 CD molecules [BR:fca04090]
    101094569 (ACKR1)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101094569 (ACKR1)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   101094569 (ACKR1)
CD molecules [BR:fca04090]
 Proteins
  101094569 (ACKR1)
SSDB
Other DBs
NCBI-GeneID: 101094569
NCBI-ProteinID: XP_003999716
Ensembl: ENSFCAG00000018619
UniProt: A0A337S1Y2
LinkDB
Position
F1:complement(67603807..67607905)
AA seq 339 aa
MGNCLQHRVADEDATKFTLGEDIWDEFNDSYDMNYNYSIVEAAAPCRSCPLLDDSSLPFF
VLASVLGILAGAAVLFALLRPLFQWRVCPERPVLVQLAVGSTLFSIVVPILAPGLNGVQS
TALCRLAHLLWYGSAFAQALLIGCHACLGPKLDVGHVAGITLWLTVGLWGGALLLGLPVT
LASDTSRGLCSLSFNKSPRFLPLLHVVASFTAFTLLPLGLLGTKALTKAWGRWPGPCVSV
LWVWFVFWWPHGVALGLDFLVRSKSLVLSTCLAQQALDLLLHLAEALAILHGVATPLLLA
LFYHQTTRTPLPSLPLSVRRPSHLDPPGGKSQLPSHLST
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggggaactgtctgcagcaccgggtggcggatgaggacgctaccaagttcaccttggga
gaagatatttgggatgagtttaatgactcctatgacatgaactacaactacagcattgtg
gaagccgccgccccctgccgctcctgtcccctgctcgacgactcctctctgcccttcttc
gtcctcgccagcgtcctgggcatccttgcgggggcagccgtgctcttcgcgcttctcagg
cctctcttccagtggcgggtctgccctgagcggccggtcctcgtacagctggccgtgggc
agcaccctcttcagtatcgtggtgcccatcctggccccggggctcaacggggtgcagagc
acagccctgtgccgcctggcacacttgctctggtacggctcagcctttgcccaggctctg
ctgatcgggtgccacgcctgcctgggccccaaactggatgtgggccacgtcgcgggcatc
accctgtggctcactgtgggactctggggaggggctcttctcctggggctgcccgtcacg
ctggccagtgacacctcccgtggactctgctccctgagcttcaacaagagccccaggttt
ctgccgcttttgcacgtggtggccagctttaccgccttcaccttgttgccactgggcttg
ttaggtaccaaggcgctgacgaaagcgtggggcaggtggccaggtccctgcgttagtgtc
ctgtgggtctggtttgttttctggtggcctcacggggtggctctggggttggactttctt
gtgaggtccaagtccctggtactgtcgacgtgtctggcccagcaggctctggacctgctc
ctgcacctggcagaggccctggcgatactccacggtgtggccacgcccctgctcctggcc
ctgttctaccaccagaccacccgcacgcccctgccctccctgcctctctcggtaagacgg
ccttctcatctggaccccccggggggcaagtcccagctcccttcacacctgtcaacctga

DBGET integrated database retrieval system