KEGG   Felis catus (domestic cat): 101094593
Entry
101094593         CDS       T02385                                 
Symbol
CXCL6
Name
(RefSeq) C-X-C motif chemokine 6
  KO
K05506  C-X-C motif chemokine 5/6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05133  Pertussis
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101094593 (CXCL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094593 (CXCL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101094593 (CXCL6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101094593 (CXCL6)
   04062 Chemokine signaling pathway
    101094593 (CXCL6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    101094593 (CXCL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101094593 (CXCL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094593 (CXCL6)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101094593 (CXCL6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101094593
NCBI-ProteinID: XP_003985379
UniProt: M3WLP6
LinkDB
Position
B1:complement(148040188..148042387)
AA seq 148 aa
MRRTWGSHSARELQIRAPLPPLEPAPLAALVAAMSLPPSRAARAPRLSGSLCALLLLLLL
LLTPPGPLASAGPVAVIVRELRCVCLTTTPGIHPKMIAKMQVIGAGPQCPKVEVIATLKN
KKEVCLDPETPVMKKAIQKILDSGKKAD
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcggagaacttggggaagccacagtgcgagggagcttcaaatccgggctcctctcccg
cctctggaacccgcacccctcgccgcactcgtggccgccatgagcctcccgccgagccgc
gccgcccgcgccccgcgcctttcgggctcgctgtgcgcgctgctcctgctgctgctgctg
ctgctgacgccgccggggcccctcgccagcgccggtcccgtcgcggtcatagtgagggag
ctgcgttgcgtgtgtttaaccaccacaccggggattcatcccaaaatgatcgctaagatg
caggtgatcggggccgggccacagtgtcccaaggtggaagtcatagccaccctgaagaac
aagaaggaagtctgtctggacccagaaacccctgtgatgaagaaagccatccagaaaatc
ttagacagtgggaaaaaggctgattaa

KEGG   Felis catus (domestic cat): 102901432
Entry
102901432         CDS       T02385                                 
Name
(RefSeq) growth-regulated protein homolog gamma-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05134  Legionellosis
fca05146  Amoebiasis
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102901432
   04668 TNF signaling pathway
    102901432
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102901432
   04061 Viral protein interaction with cytokine and cytokine receptor
    102901432
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102901432
   04657 IL-17 signaling pathway
    102901432
   04062 Chemokine signaling pathway
    102901432
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102901432
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102901432
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102901432
  09163 Immune disease
   05323 Rheumatoid arthritis
    102901432
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102901432
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    102901432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    102901432
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   102901432
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102901432
NCBI-ProteinID: XP_023108817
LinkDB
Position
B1:complement(147887134..147889310)
AA seq 103 aa
MAHTAPRAPRLLGAALLLLLLVPAARRAAGAPVVTELRCQCLQTVQGIHLKNIQSVKVTQ
SGPHCAHTEVIATLKNGHEACLNPEAPMVKRIIEKMLSKGSNN
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcccacaccgcgccccgcgctccccggctcctcggcgccgcgctgctgctcctgctc
ctggtccccgccgcccggcgcgccgcaggggcgcccgtcgtcaccgagctgcgctgccag
tgcctgcagaccgtgcagggcattcacctcaagaacatccagagcgtcaaggtgacgcag
tcgggcccccactgcgcccacaccgaagtcatagccactctcaagaacggacacgaagcc
tgtctcaaccccgaagcccccatggtcaagagaatcatcgaaaagatgctaagcaagggc
agcaacaactga

KEGG   Felis catus (domestic cat): 111560177
Entry
111560177         CDS       T02385                                 
Name
(RefSeq) growth-regulated protein homolog gamma-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05134  Legionellosis
fca05146  Amoebiasis
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111560177
   04668 TNF signaling pathway
    111560177
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111560177
   04061 Viral protein interaction with cytokine and cytokine receptor
    111560177
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111560177
   04657 IL-17 signaling pathway
    111560177
   04062 Chemokine signaling pathway
    111560177
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111560177
  09171 Infectious disease: bacterial
   05134 Legionellosis
    111560177
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111560177
  09163 Immune disease
   05323 Rheumatoid arthritis
    111560177
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111560177
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    111560177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    111560177
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   111560177
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 111560177
NCBI-ProteinID: XP_023108818
LinkDB
Position
B1:complement(147899478..147901525)
AA seq 103 aa
MAHTAPRAPRLLGAALLLLLLVPAARRAAGAPVVTELRCQCLQTVQGIHLKNIQSVKVTQ
SGPHCAHTEVIATLKNGHEACLNPEAPMVKRIIEKMLSKGSTN
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcccacaccgcgccccgcgctccccggctcctcggcgccgcgctgctgctcctgctc
ctggtccccgccgcccggcgcgccgcaggggcgcccgtcgtcaccgagctgcgctgccag
tgcctgcagaccgtgcagggcattcacctcaagaacatccagagcgtcaaggtgacgcag
tcgggcccccactgcgcccacaccgaagtcatagccactctcaagaacggacacgaagcc
tgtctcaaccccgaagcccccatggtcaagagaatcatcgaaaagatgctaagcaagggc
agcaccaactga

KEGG   Felis catus (domestic cat): 493836
Entry
493836            CDS       T02385                                 
Symbol
CXCL8
Name
(RefSeq) interleukin-8 precursor
  KO
K10030  interleukin 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04072  Phospholipase D signaling pathway
fca04218  Cellular senescence
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04932  Non-alcoholic fatty liver disease
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05135  Yersinia infection
fca05142  Chagas disease
fca05144  Malaria
fca05146  Amoebiasis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05219  Bladder cancer
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    493836 (CXCL8)
   04072 Phospholipase D signaling pathway
    493836 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493836 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493836 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    493836 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493836 (CXCL8)
   04621 NOD-like receptor signaling pathway
    493836 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    493836 (CXCL8)
   04657 IL-17 signaling pathway
    493836 (CXCL8)
   04062 Chemokine signaling pathway
    493836 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493836 (CXCL8)
   05202 Transcriptional misregulation in cancer
    493836 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    493836 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    493836 (CXCL8)
   05171 Coronavirus disease - COVID-19
    493836 (CXCL8)
   05164 Influenza A
    493836 (CXCL8)
   05163 Human cytomegalovirus infection
    493836 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493836 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493836 (CXCL8)
   05135 Yersinia infection
    493836 (CXCL8)
   05133 Pertussis
    493836 (CXCL8)
   05134 Legionellosis
    493836 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493836 (CXCL8)
   05144 Malaria
    493836 (CXCL8)
   05142 Chagas disease
    493836 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493836 (CXCL8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493836 (CXCL8)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493836 (CXCL8)
   04932 Non-alcoholic fatty liver disease
    493836 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493836 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493836 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493836 (CXCL8)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493836 (CXCL8)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   493836 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 493836
NCBI-ProteinID: NP_001009281
Ensembl: ENSFCAG00000004666
UniProt: Q9XSX5
LinkDB
Position
B1:complement(148127536..148130339)
AA seq 101 aa
MTSKLVVALLAAFMLSAALCEAAVLSRISSELRCQCIKTHSTPFNPKLIKELTVIDSGPH
CENSEIIVKLVNGKEVCLDPKQKWVQKVVEIFLKKAEKQNA
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggttgttgctctcttagcagctttcatgctttctgcagctctgtgt
gaagctgcagttttgtcaagaattagttcagaacttcgatgccagtgcataaaaactcat
tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac
tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaaagaggtgtgcctggacccc
aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat
gcataa

DBGET integrated database retrieval system