KEGG   Felis catus (domestic cat): 101095108
Entry
101095108         CDS       T02385                                 
Symbol
CLEC4D
Name
(RefSeq) LOW QUALITY PROTEIN: C-type lectin domain family 4 member D
  KO
K10058  C-type lectin domain family 4 member D
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101095108 (CLEC4D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101095108 (CLEC4D)
   04090 CD molecules [BR:fca04090]
    101095108 (CLEC4D)
   04091 Lectins [BR:fca04091]
    101095108 (CLEC4D)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101095108 (CLEC4D)
CD molecules [BR:fca04090]
 Proteins
  101095108 (CLEC4D)
Lectins [BR:fca04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    101095108 (CLEC4D)
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 101095108
NCBI-ProteinID: XP_023112516
LinkDB
Position
B4:complement(42637306..42645193)
AA seq 212 aa
MSQEPQNKQEGQPSHLIPWAIAIFFISLLSACFIANCLVTHYSFLHCRRRMGMFKLPEYY
KKITCTKEESKLKGSTWNCCPTGWRSFQDSCYLPLNDNKTWAKSERNCTDMGAHLVTITS
EAEQNFIVQFLDRRFSYFLGLTDEDHEGQWSWVDKTPFDPHIVFWHEGEPNNYKQNENCV
ILXYVQDKWAWNDFPCNFERRRICKLPGTPFN
NT seq 639 nt   +upstreamnt  +downstreamnt
atgagccaagaacctcaaaataaacaagaaggccagccttcccacctgatcccttgggcc
atcgctatttttttcatctcactcctcagtgcttgttttattgcaaattgtttggtgact
cattacagctttctacactgcaggagacgcatgggaatgttcaagttaccagagtattac
aagaagataacatgcaccaaagaggaatcaaaactgaaaggaagcacctggaattgctgt
cctactggttggagatccttccaggacagttgctatttacctctgaatgacaacaagaca
tgggcaaagagcgagaggaactgcacggacatgggggctcatctggtcaccatcacctca
gaagctgagcagaactttattgttcaatttttggatagacggttttcatatttcctggga
cttacagatgaggaccatgaaggccagtggtcctgggtggacaagacaccatttgaccca
catattgtattctggcatgagggtgaacccaacaactataaacagaatgaaaattgtgtt
atccttngttatgtccaagacaaatgggcctggaatgactttccttgtaactttgagaga
agaagaatttgcaagttacctggaacaccattcaactag

DBGET integrated database retrieval system