KEGG   Felis catus (domestic cat): 101095243
Entry
101095243         CDS       T02385                                 
Symbol
WASL
Name
(RefSeq) neural Wiskott-Aldrich syndrome protein
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04520  Adherens junction
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101095243 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101095243 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101095243 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095243 (WASL)
   05135 Yersinia infection
    101095243 (WASL)
   05100 Bacterial invasion of epithelial cells
    101095243 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095243 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101095243 (WASL)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101095243 (WASL)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     101095243 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 101095243
NCBI-ProteinID: XP_011278829
UniProt: A0A2I2U0M1
LinkDB
Position
A2:complement(142659455..142721925)
AA seq 505 aa
MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKTKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGAPPPPPNRMYPPPPPALPSSAPSGPPP
PPPPLSLAGSAAPPPPPPPPPPPGPPPPPGLPSDGDHQVPPPAGSKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgagctccggccagcagcagccgcctccaccgcggagggtcaccaatgtggggtccttg
ctgctcaccccgcaggagaacgagtctctcttcactttcctcggcaagaaatgtgtgact
atgtcttcagcggtggtacagttatatgcagcagatcgtaactgtatgtggtcaaagaag
tgcagcggtgttgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgatattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcataccttcgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaattccgaaaagcagttacagacttgttgggccgg
cgacaaaggaaatctgagaaaagacgagatcccccaaatggtcctaatctacccatggca
acagttgacataaaaaatccagaaatcacaaccaatagattttatggtccacaagtcaac
aacatctcccataccaaagaaaagaaaaaaggaaaaacaaaaaagaagagattaaccaag
gcagatattggaacaccaagcaatttccagcacattggacatgttggttgggatccaaat
actggctttgacctgaataatttggatccagaattgaagaatctttttgatatgtgtgga
atctcagaggcacaacttaaagaccgagaaacatcgaaagttatatatgacttcattgaa
aaaacaggaggtgtggaagctgttaaaaatgaactacgaaggcaagcgccaccgccgcca
ccgccgtctaggggagggccgcctcctcccccgccacccccgcacagctcaggccccccg
ccccctcccgccagggggagaggcgctcctcctccaccaccttctagagctcccaccgcc
gcgcctccgccaccgcctccgtccaggccaggtgtgggagcccctccaccgccaccaaat
aggatgtaccctcccccgcctccagcccttccctcctcagcaccatcggggcctccaccg
ccacctccacctctgtcgttggccggctcagcggcaccgcccccgccacctccgcctccg
cctcccccggggccgccacctccgcctggcctcccttctgacggtgaccatcaggttcca
cctcctgcaggaagcaaagcagctcttttggatcaaattagagagggtgctcagctaaaa
aaggtggaacagaacagtcgacctgtgtcctgctccggaagggatgcacttttagaccag
atacgacagggtattcagctgaaatctgtatctgatggccaagagtctacaccaccaaca
cctgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaggatgaagatgatgaagaagattttgaggacgat
gatgaatgggaagactga

KEGG   Felis catus (domestic cat): 111557362
Entry
111557362         CDS       T02385                                 
Name
(RefSeq) uncharacterized protein LOC111557362
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04520  Adherens junction
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111557362
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111557362
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111557362
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111557362
   05135 Yersinia infection
    111557362
   05100 Bacterial invasion of epithelial cells
    111557362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    111557362
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    111557362
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    111557362
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     111557362
SSDB
Other DBs
NCBI-GeneID: 111557362
NCBI-ProteinID: XP_023097917
LinkDB
Position
D3:1079085..1087574
AA seq 360 aa
MTRNTSKQAAASTEDKGTSRNPNTLQQGSGSSAATPLSNGGKQLWDRQNPDEAQTHDAPR
EKPDSRASTLPAQEGQTSVAAEGSWEELVRAGEPPRLAPGSLSRASASSTLTASPTHSGA
PSARAPSLRQRPLIRPGAPSRRATSLRRRPPTRPGAQSPQAASLHQRPITAGHLPAPAPP
PASAPPPHPFPGAPSPRAPSLRRASAPHPPWRPVTAGRVSAPHQRSLTHPRQARLPAPLP
RRSRLRVSRLCAKPVPPPPPAPPRQRPPTPGSSPQPRRAPDYTPLAGEGSKKAGREPQDS
RPRPPPSPVTPRPHLPEAGPHSGRVRLRPGGGGRGGAAPLGASGTAGGGSGGAPATASRK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgacacgcaacaccagcaagcaggcagcagcctccacagaagacaaagggactagccgc
aacccgaacacccttcagcaggggagtggctcaagtgcggccacaccactcagcaacgga
ggaaagcagctgtgggacaggcagaacccggatgaagcgcagacgcacgacgcgccaaga
gagaagccagactcgagagcgtccacactgccagcccaggaaggacagacatcagtggct
gccgagggctcgtgggaggagctggtgagggctggagagccgccccgcctggcacccggg
tctctgagccgcgccagtgcttcctccaccctcacggcgtcccccacccactcgggcgcc
ccgtcagcgcgagcgccgtctctgcgccagcgccccctaattcgccctggcgccccatca
cggcgggccacatctctgcgccggcgccccccaactcgcccgggcgcccagtcacctcag
gccgcatctttgcaccagcgccccatcacggcgggccacctccctgcgccagcgccgcca
cccgcctctgcgccccctccccaccccttccccggcgccccgtcaccgcgggccccatct
ctgcgccgcgccagcgccccccacccaccctggcgccccgtcaccgcgggccgcgtctcc
gcgccgcaccaacgctccctcacacacccccgccaggcccgactcccggcgcccctcccc
cggcgatcccgtctccgcgtatcgcgtctctgcgccaaaccagtgccacctccacccccg
gcgcccccgcgccagcgccccccaactcccggcagctccccccaaccccggcgcgccccc
gactacacgcccctggcgggggagggctctaagaaggccgggcgcgaaccgcaagactcc
cgaccccgacccccaccgtcccccgtcacgccgcggcctcacctacccgaggctggaccg
cactccggccgcgtccggctgaggcctgggggcggcggtcgaggcggcgccgctccgcta
ggcgcatccgggaccgcgggaggaggaagcggcggcgcgcccgctacggcgagccggaag
tga

KEGG   Felis catus (domestic cat): 111559482
Entry
111559482         CDS       T02385                                 
Name
(RefSeq) actin cytoskeleton-regulatory complex protein PAN1-like
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04520  Adherens junction
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111559482
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111559482
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111559482
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111559482
   05135 Yersinia infection
    111559482
   05100 Bacterial invasion of epithelial cells
    111559482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    111559482
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    111559482
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    111559482
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     111559482
SSDB
Other DBs
NCBI-GeneID: 111559482
NCBI-ProteinID: XP_023106059
LinkDB
Position
A1:complement(1044921..1046302)
AA seq 351 aa
MSAAVETAAPTPSCLTSHYPGFTPGAAATQGKAPPPQNNGERQVLWLNPYNPTTSSKSNK
LEAKDSQWGCFPHFLPKMHQLGLKAIPGPGVKGKMANGSGTSNQVGEPKPIPPRGGRDGS
RRSRRFGPSIITPQPATNNPLLRKVEQNGAKHIFGTKAHVKGKIRREESATGSAASPSAI
RDPAKQYVKSKSRAAQPREEKSDGGDPVGEEAAPSPRKTWGPRATAETGKIPRDLPPPRP
GQPPPHERPPPLASASPSPPGLALTLAALRAAREDACDMSEARRRPRGPDAAAATAAAPR
GINPGSVGGSGGCPHPSPPPQSPPPPPPPPEAALLPATPTIGGPGLERQRG
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtctgcagcggtggaaacagcagcgcccactcccagctgcctcaccagccattaccca
ggcttcaccccgggggcagctgccacccaaggaaaggctcctccccctcaaaacaacggg
gagagacaagtcctttggctaaacccctacaacccaaccacgtcctctaagagcaacaaa
ttagaggcgaaggactcacaatgggggtgttttcctcactttctgccaaagatgcaccag
ctggggttgaaggcgattcctggtcctggggtaaaaggaaaaatggcaaatggatcagga
acatctaaccaggtgggagaaccaaagcccattccaccaagaggaggccgagacgggagt
aggaggtcaaggaggtttggcccctctattattactccacagcccgcgaccaacaatccc
ctcctacgtaaagtggagcaaaacggcgcaaaacatatatttgggaccaaagcccacgtg
aaaggcaaaatccggagggaggagtcggcgaccggcagcgctgcctccccgtccgccatt
agagacccagccaaacaatacgtgaagagcaagagccgcgcagcgcagcccagggaagag
aagagcgacggaggggacccggtgggggaagaggcagcaccctcgccccgaaaaacttgg
ggacctcgggctaccgcggagacaggaaaaataccccgcgacctcccaccgccccggccc
gggcaacccccgccccacgagcgacccccgcctctggcgtccgcctcacccagccctccc
ggcctcgccctcactctcgcagcccttcgggccgcacgcgaagacgcctgtgacatgagc
gaagcccggaggagaccccgaggccccgacgcggcagcggcgacggcggccgcgccgcgg
ggtattaatcccgggtcggtgggaggctccggaggctgccctcacccatctccgcctccc
cagtcgcctccgcctccgcctcctcctcccgaggctgcgctgctcccagccacccccact
atcggcggacctgggctggaaagacagcggggataa

DBGET integrated database retrieval system