KEGG   Felis catus (domestic cat): 101095261
Entry
101095261         CDS       T02385                                 
Symbol
PLG
Name
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
fca05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101095261 (PLG)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101095261 (PLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101095261 (PLG)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101095261 (PLG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101095261 (PLG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101095261 (PLG)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     101095261 (PLG)
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101095261 (PLG)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101095261 (PLG)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 101095261
NCBI-ProteinID: XP_006932192
Ensembl: ENSFCAG00000023975
LinkDB
Position
B2:complement(147295522..147339351)
AA seq 812 aa
MEHKEVILLLLLFLKSGHGDPLDDYVNTQGASLVSLTKKQLSAGSIEECAARCEEETGFI
CRSFQYHSKEQHCVIMAENSKNSAVFRMRDVVLFEKKIYLSECKIGNGKSYRGTMSKTKN
GVTCQKWSDNAPHKPNYSPDKYPAEGLEENYCRNPDSDEDGPWCYTTDPNKRFDYCDIPE
CEDECMHCSGENYEGKISKTISGIKCQSWNSQTPHAHGYIPSKFPNKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEFCDIPRCTTPPPTPGPTYECLKGKGENYRGKVSLTVSGHTCQRWS
EQTPHKHNRTPENFPCKNLDENYCRNPDGETTPWCYTTNSEVRWEYCQIPSCESSPLSSE
HLDAPVSVPPEQTPVVQECYRGNGQSYRGTSSTTITGKKCQPWSSMVPHRHVKTPERYPD
AGLTMNYCRNPDADKSPWCYTTDPSVRWEFCNLKKCPDREESATKSPTVSQVPSAEDPSE
SDCMFGNGKGYRGKRATTVSGIPCQEWGAQEPHRHGIFTPVTNPQSGLEKNYCRNPDGDV
NGPWCYTMSPRKLFDYCDVPQCASASFDCGKPQVEPKKCPGRVVGGCVANPHSWPWQVSL
RTRFGQHFCGGTLIAPEWVLTAAHCLERSSRPAAYKVILGAHRELNLETDVQDIEVSKLF
LEPTRADIALLKLSRSAVITSKVIPACLPPPNYVVADRTLCYITGWGDTQGTFGAGLLKE
AQLPVIENKVCNRYEYLNGRVKSTELCAGNLAGGTDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRFVPWIEGIMRNN
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggaacacaaggaagtcatccttctacttcttttatttctgaaatcaggtcacggagac
cccctggatgactatgtaaatacccagggggcttctctggtaagcctcactaagaagcag
ctgtcagcaggaagcatagaagaatgtgcagcacgatgtgaggaggaaacaggattcatt
tgcaggtcattccaatatcacagcaaagagcaacattgtgtgatcatggctgaaaacagc
aagaattcggctgtcttcaggatgagagatgtggttttatttgaaaagaagatctatctt
tcagagtgcaagattggaaacgggaagagctacagggggacgatgtccaaaacgaagaat
ggtgtcacctgtcaaaaatggagtgacaatgctccgcacaaacctaactattcacctgat
aagtaccctgcggaggggctggaggagaattactgcaggaaccccgacagtgacgaggac
ggaccctggtgctacaccacagacccaaacaagaggttcgactactgcgacattccagag
tgtgaagatgaatgtatgcactgcagtggggaaaactatgagggcaaaatttccaagacc
atctctggaatcaaatgccagtcctggaactctcaaaccccacatgctcacggatatatt
ccttccaaatttccaaacaagaacctgaagatgaattactgccgtaaccctgatggggag
ccccgcccgtggtgtttcaccacagatcccaacaaacgctgggagttctgtgacatcccg
cgctgtacaacaccacccccaactcctggtccaacgtatgagtgtctgaaaggcaaaggt
gaaaactaccgagggaaggtgtccctcaccgtatctggacacacttgtcagcgctggagc
gaacagacccctcacaagcacaacaggacccctgaaaacttcccttgcaaaaatttggat
gaaaactactgtcgcaaccctgatggagaaacgactccgtggtgctatacgaccaacagc
gaagtgaggtgggaatactgtcagatcccgtcctgtgagtcctcgccactgtcctcagaa
catttggacgccccagtttcagtaccacctgaacaaactcccgtggtccaggagtgctac
cgaggcaacggacagagttatcgaggcacatcatctactactatcacaggaaagaagtgt
caaccttggtcatctatggtaccacaccgacatgtgaagaccccagaacgctacccagac
gccggcctgaccatgaactactgcaggaacccagacgccgacaagagcccttggtgttac
accaccgaccccagtgtccgctgggaattctgtaacctgaaaaaatgtccagacagagaa
gagagtgccaccaagtccccgactgtttcccaggttccgagtgcagaggacccttccgag
tcagactgcatgttcgggaatggcaaaggataccggggcaagagggcaaccaccgtttcg
ggcatcccctgccaggagtggggagcccaggagccccacagacatggtattttcactcct
gtgacaaatccacagtcaggtctggaaaaaaactactgccgcaatcccgatggtgatgtc
aatggtccttggtgctacacgatgagtccaaggaaactttttgactactgtgatgtccct
cagtgtgcgtccgcttcatttgattgtgggaagccccaggtggagccgaagaaatgtcct
ggaagggttgtaggtggatgtgtggccaacccacattcttggccctggcaagtcagtctt
agaacaagatttggacagcacttctgtggagggactttaatagccccagagtgggtgttg
acagctgcccactgcttggagagatcctcaaggcctgcagcgtataaggtcatcctgggc
gcacaccgagaactaaatcttgaaacggatgttcaggacatagaggtatccaagctgttc
ttggagcccacacgtgcagatatcgccttgctgaagctaagcagatccgccgtcatcacc
tccaaagtgatcccagcttgtctgccacccccaaattatgtggttgctgaccggacatta
tgttacatcactggctggggagacacccaagggacctttggcgctgggctcctcaaggaa
gcccagctaccggtgattgaaaataaggtgtgcaatcgctacgagtatctcaacggaaga
gtcaaatccacagagctttgtgctgggaatttggccggaggcaccgacagttgtcagggt
gacagcggagggcctctggtctgcttcgagaaggacaagtacattttacaaggagtcact
tcttggggtcttggctgtgcccgccccaataagcccggtgtctatgttcgtgtttcaagg
tttgttccttggattgaagggataatgagaaacaattaa

DBGET integrated database retrieval system