KEGG   Felis catus (domestic cat): 101095461
Entry
101095461         CDS       T02385                                 
Symbol
TFAP4
Name
(RefSeq) transcription factor AP-4 isoform X1
  KO
K09108  transcription factor AP-4
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101095461 (TFAP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095461 (TFAP4)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    101095461 (TFAP4)
SSDB
Motif
Pfam: HLH COE1_HLH
Other DBs
NCBI-GeneID: 101095461
NCBI-ProteinID: XP_006942451
Ensembl: ENSFCAG00000011227
LinkDB
Position
E3:41021491..41049859
AA seq 347 aa
MFCMMVVHTPCFVLSTGSTVICLSGCLALWDGAEPTLSCGLANIPLTPETQRDQERRIRR
EIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQN
TQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRM
MLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT
HHPTVIVPAPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQERQEQEEE
QRRAVIVKPGRSCPEAHASDTASDSEASDSDAMDQSREEPAGNGGLP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgttctgcatgatggttgtgcataccccatgctttgtcctttctacagggtcaactgtc
atctgtctgtctgggtgtctggctttgtgggacggtgcagagcccactctgtcctgtggc
cttgccaacattccactgacccctgagacgcagcgggaccaggagcggcggattcggcgg
gagatcgccaacagcaacgagcggaggcgcatgcagagcatcaacgcgggcttccagtcc
ctcaagaccctcatcccccacacagacggagagaagctcagcaaggcagccattctccag
cagacggcggagtacatcttctccctggagcaggagaagaccaggctcctgcagcagaac
acacagctcaagcgctttatccaggagctgagcggctcatcccccaagcggcggcgggca
gaggacaaggatgagggcatcggctcgccggacatctgggaagacgagaaggcagaggat
ctgcgtcgggagatgatcgagctccggcagcagctggacaaggagcgctcggtgcgcatg
atgctggaggagcaggtgcgctcgctggaggcccacatgtacccagaaaagctcaaggtg
attgcacagcaggtgcagctgcagcagcagcaggagcaggtgcggctgctgcaccaggag
aaactggagcgggaacagcagcacctgcggacccagctgctgccccccccggcccctacc
caccaccccacagtgatcgtgccggcaccaccccctccctcccaccacatcaacgtcgtc
accatgggcccctcctcggtcatcaactctgtttccacgtcccggcaaaatctggacacc
atcgtgcaggcgatccagcacatcgagggcacccaggaaaggcaggagcaggaggaggaa
cagcgacgagccgtcatcgtgaagccaggccgcagctgcccggaggcccacgcctccgac
actgcctccgattcggaggcctcggacagcgacgccatggaccagagccgggaggagcca
gcagggaatggggggcttccctga

DBGET integrated database retrieval system