KEGG   Felis catus (domestic cat): 101095874
Entry
101095874         CDS       T02385                                 
Symbol
IL24
Name
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101095874 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101095874 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101095874 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101095874 (IL24)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   101095874 (IL24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 101095874
NCBI-ProteinID: XP_003999499
Ensembl: ENSFCAG00000013829
LinkDB
Position
F1:complement(37771136..37775379)
AA seq 183 aa
MGFPGLRTSLLCLSLILHLWSQGPGIQGQEFQFGPCRVEGVVLQELWEAFWAMKDIVQAK
DNITNVRLLRKEVLQNVSNAESCYLIRALLKFYLNTVFKNYQDKAADFRVRKSFSTLANN
FVVIVSKLQPSQENEMFSVSDSARRRFLLFQRAFKQLDIEAAQTKAFGEVDILLTWMEKF
YQL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgggctttccagggctgaggacttccctcctctgcctgagtctgatcctacatctttgg
agccaggggccaggcatccagggccaagagttccaattcggaccctgccgggtggaggga
gtcgtcctccaggaactgtgggaggccttctgggccatgaaggacattgtgcaagctaag
gataacatcacgaatgtccggctactacggaaggaggttctgcagaacgtctcgaacgct
gagagctgttaccttatccgtgccctgctgaagttctacttgaataccgttttcaaaaac
taccaggataaggcagctgacttcagggtccggaagtcattctccactctggccaacaac
ttcgttgtcatcgtgtcaaaactacagcccagtcaggaaaatgagatgttttctgtcagt
gacagtgcgcgcaggcggtttctgctgttccagagagcatttaaacagttggacatagaa
gcggcccagaccaaagcctttggagaagtggacatcctcttgacctggatggaaaaattc
taccagctctga

KEGG   Felis catus (domestic cat): 101096130
Entry
101096130         CDS       T02385                                 
Symbol
IL20
Name
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101096130 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096130 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096130 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096130 (IL20)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   101096130 (IL20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 101096130
NCBI-ProteinID: XP_023103223
Ensembl: ENSFCAG00000013827
LinkDB
Position
F1:complement(37796538..37799043)
AA seq 176 aa
MKASGLPICLLSAVFYLFWTPSAGLKTLHLGSCVITTNLQAMRNGFSEIRDSVQAKDEII
DIRILRKTESLQDTKPADQCCLLRRVLRLYLDRVFKNYQTPDHHILRKTSSLANSFLTIK
KDLRVCHAHMTCPCGEEAVEKYSQILSHFEELTPQAAVVKALGELDILLQWMEELA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcgtctggtcttcccatctgccttctctctgctgtgttttatctcttctggaca
ccttctgctgggctgaagacactccatttgggaagttgtgtgatcaccacaaaccttcag
gcaatgcgaaacgggttttctgagatacgggacagtgtgcaagccaaagatgaaatcatt
gacatcagaatcttgaggaagactgagtctttgcaagacaccaagcctgcagatcagtgc
tgcctcctccgccgtgtactgagactgtacctggacagggttttcaaaaactatcagacg
cctgaccaccatatcctccggaagaccagcagtcttgccaactcttttcttaccatcaag
aaggacctccgggtctgccatgcccacatgacatgcccttgtggggaggaagcagtggag
aaatacagccagattctgagtcacttcgaagagcttacgcctcaggcagcggtggtgaag
gctttgggagagctggacattctcctgcagtggatggaggagctggcctag

DBGET integrated database retrieval system