KEGG   Felis catus (domestic cat): 101095926
Entry
101095926         CDS       T02385                                 
Symbol
DDX58
Name
(RefSeq) probable ATP-dependent RNA helicase DDX58 isoform X1
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101095926 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101095926 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    101095926 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101095926 (DDX58)
   05160 Hepatitis C
    101095926 (DDX58)
   05171 Coronavirus disease - COVID-19
    101095926 (DDX58)
   05164 Influenza A
    101095926 (DDX58)
   05162 Measles
    101095926 (DDX58)
   05168 Herpes simplex virus 1 infection
    101095926 (DDX58)
   05169 Epstein-Barr virus infection
    101095926 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101095926 (DDX58)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101095926 (DDX58)
Pattern recognition receptors [BR:fca04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   101095926 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C ResIII DEAD AAA_22 AAA_25
Other DBs
NCBI-GeneID: 101095926
NCBI-ProteinID: XP_006939261
Ensembl: ENSFCAG00000001294
UniProt: M3VWD9
LinkDB
Position
D4:complement(56873483..56911562)
AA seq 929 aa
MTAEERRNLRAFQDYVIKILDPTYILSYMSPWFKDDEVQYIWAEKNNKGTMEAASLFLKF
LLELQEEGWFRGFLDALAHAGYSGLYEAIESWDFQTIERLEEYRSLLKRLQPEFKTTVNP
KDILPEVSKCLISQECEEIMQVCSNKGLMAGAEKMVECFLRSDKENWPKTLKLALDKEES
KFSELWTVDKGAKNIDVKVLEDDEMETSDIQIFYKEESECQNLSQNSCPSSEVSHIYTPV
KPRNYQLELALPAKEGKNTIICAPTGCGKTFVSLLICEHHLKNFPQGQKGKVVFFAVQLP
VYEQQKSVFSNYFERLGYKVAGVSGATSENVSVKQIVENNDIIILTPQILVNSLKNGTIP
SLSVFTLMIFDECHNTGKHHPYNMIMFNYLDQKLGGSSDPLPQVIGLTASVGIGDAKSTA
EAVEYICRLCASLDTSVIATVKDNLEELEEIVYKPQKFFRKVESRTTDRFKCIISQLMRE
TESLAKSIFDEIGTITLEGISQIRNREFGTQKYEQWIVTVQKACTVFQLPDKDEESRICK
ALFLYTSHLRKYNDALIINEHARMKDALDYLKDFFTNVRAAGFDEIEQDLTRRFEEKLQK
LESVSMDPSNENPKLKDLCFILQEEYHLNPESRTILFVKTRALVDALKKWIEENSELSFL
KPGILTGRGKTNQNTGMTLPAQKCALDAFRTNGDKKILIATSVADEGIDIAECNLVILYE
YVGNVIKMIQTRGRGRARGSKCFLLTSNAVVIEKEKINIYKEKMMNDSISMLQTWNEAVF
KEKVLQIQIQEKVIRDSQGKVEPVPDKENKKLLCRKCKAFACYTVDIRVVEECHYTVVGD
AFRKCFVSKLHPKPKSFGYFEKRAKIFCARPNCSHDWGIHVKYKIFEIPVIKIESFVVED
IATGAQKLYAKWKDFHFEKIPFDAKEMPK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgacggcggaggagaggaggaatctgcgcgccttccaggactatgtcatcaagattctg
gaccctacctatatcctgagctacatgtcgccctggtttaaggacgatgaggtgcagtat
atttgggctgagaaaaacaataagggcacgatggaggctgcctcactttttcttaagttc
ctattggagctccaggaagaaggctggttccgtggctttttggatgcccttgctcatgca
ggttattctggactttatgaagccattgaaagctgggatttccaaaccattgaaaggttg
gaggagtataggtcactgttgaagcgtttacaaccagaatttaaaactacagttaatcca
aaagatatccttcctgaagtatctaaatgtttaattagtcaggaatgtgaagaaattatg
caggtttgttccaacaaggggctgatggcaggtgcagagaaaatggttgaatgctttctc
agatcggacaaggaaaactggcccaaaactttgaaacttgctttggacaaagaagagagc
aagttcagtgaactgtggactgtggacaaaggtgcaaagaatattgacgtgaaagttctt
gaggatgatgaaatggaaacttctgacatacagattttctacaaggaagaatctgaatgc
cagaatcttagtcagaattcatgtccatcttcagaagtctctcatatttacaccccagtg
aagccaagaaattaccaactagagcttgctttgcctgctaaggaaggaaaaaacacaata
atatgtgctcctactggttgtggaaaaacctttgtttcacttcttatatgtgagcatcat
cttaaaaattttccgcaaggacaaaaggggaaggttgtcttttttgctgttcaactccca
gtgtatgaacagcagaaatctgtgttctcaaactattttgaaagacttgggtacaaagtt
gcaggtgtttctggagcaacatctgagaatgtctcagtgaaacagattgttgagaacaat
gacatcataattttaactccacagattcttgtgaatagtcttaaaaatgggactattcca
tcactctctgtctttactttgatgatatttgatgaatgtcacaatactggtaaacaccat
ccttataatatgatcatgtttaattatctagatcagaaacttggaggatcttcagaccca
ctgcctcaggtcattgggctgactgcctcggttggcattggggatgccaaaagcacagca
gaagccgtggaatatatctgcagactgtgtgcttctcttgacacatcagtgatagcaaca
gtcaaagacaacttggaggaactggaagaaattgtttataagccccaaaagtttttcagg
aaagtggaatcacggaccactgacagatttaaatgcatcatctctcagctgatgagggaa
acagagagtctggcaaagagtatctttgacgaaattggtaccataactctcgaaggtata
tctcaaattcgaaatagggaatttggaacgcagaaatatgaacaatggattgttactgtt
cagaaagcatgcacggtgtttcagttgcctgacaaagatgaagagagcaggatttgtaaa
gcactgtttttgtacacttcccatttgcggaaatataatgatgccctcattatcaatgag
catgcgcgaatgaaagatgctctggattacttgaaagacttcttcaccaacgtccgagcg
gcaggatttgatgagattgagcaagatctcactcggagattcgaagaaaagctgcagaaa
ctggaaagcgtttctatggatcccagcaatgagaacccaaaactcaaagatctctgcttc
atcttgcaagaggagtaccacttaaacccagagagtagaaccatcctctttgtgaaaacc
agagcacttgtggatgctttgaagaaatggattgaagaaaattctgaactcagctttcta
aaacctggcatattgactggacggggcaaaacaaatcagaacacagggatgacactccca
gcacagaagtgtgcattggatgcattcagaactaatggagataaaaagattttgatcgcg
acctcagttgctgatgaaggcattgacattgctgagtgcaatttggtcatcctgtatgag
tatgtgggcaatgtcatcaaaatgatccaaactagaggcagaggaagagcgagaggtagc
aagtgcttccttctgactagtaatgctgttgtaattgaaaaagaaaaaataaatatatac
aaagaaaaaatgatgaatgactccatttcaatgcttcagacatggaatgaagcagtgttt
aaagaaaaggttctccagatacagattcaagaaaaagtcatcagggatagtcaaggaaaa
gtagaacctgtacctgataaggaaaataaaaaactgctctgcagaaagtgcaaagccttt
gcatgttacactgttgatatcagagtggtggaggaatgccattacactgtggttggagat
gctttcaggaagtgctttgtgagtaaactacaccccaaaccaaagagctttggatatttt
gagaagagagcaaagatcttctgtgccagaccaaactgcagccatgactggggaatccat
gtgaagtataagatatttgagattccagttataaaaatagaaagttttgtggtggaggat
attgcaactggagctcagaaactatatgcaaagtggaaggactttcactttgagaagata
ccatttgatgctaaggaaatgcccaaatga

DBGET integrated database retrieval system