KEGG   Felis catus (domestic cat): 101096291
Entry
101096291         CDS       T02385                                 
Symbol
FCER2
Name
(RefSeq) low affinity immunoglobulin epsilon Fc receptor isoform X3
  KO
K06468  low affinity immunoglobulin epsilon Fc receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04640  Hematopoietic cell lineage
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101096291 (FCER2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101096291 (FCER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101096291 (FCER2)
   04091 Lectins [BR:fca04091]
    101096291 (FCER2)
CD molecules [BR:fca04090]
 Proteins
  101096291 (FCER2)
Lectins [BR:fca04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    101096291 (FCER2)
SSDB
Motif
Pfam: Lectin_C CENP-F_leu_zip AIP3 DUF6779 ATG14 UL45 DUF1664 Exonuc_VII_L FUSC-like TMPIT
Other DBs
NCBI-GeneID: 101096291
NCBI-ProteinID: XP_011287065
Ensembl: ENSFCAG00000001601
LinkDB
Position
A2:6120979..6132222
AA seq 302 aa
MNPHGQGEGRGPGPTVGSQEFPNLPGRRRWCCRQGTQMALLGLVTVMLWAGLLTLLLFWH
WDAVQNLKQLEETAAQNVSQVAKDLERHRGDEMAQKSRAAQVSQNMEEIQAEQKRMKAQD
SELSRNLDGLRSDLSNLKSQSLNERRTALHSLERLQQEVVKLWVELHVSNGSTCNTCPEN
WVNFQRKCYYFGEGAKKWIQARFACSKLQGRLVSIHSQEEQDFLAKRANRKGTWIGLRDL
DIEGEFIWMDENPLNYSNWRPGEPNNQGQGEDCVMMQGSGQWNDAFCGSRLDGWVCDRLA
TC
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaatcctcacggccagggcgagggcagggggcccgggcccacggtggggagtcaagag
ttcccaaaccttcccggaaggcggcggtggtgctgtcggcaagggacccagatggcactg
ttggggctggtgaccgtcatgctgtgggccgggctgctgaccctgctcctcttctggcac
tgggacgctgtacagaacctgaaacagctggaagaaaccgccgcccagaacgtctctcag
gttgccaaggacttggaaagacacagaggggacgagatggcccagaaatcccgggctgcc
caggtgtcacagaacatggaggaaatccaagctgaacagaaaaggatgaaagctcaggac
tctgagctctcccggaacctggatggacttcgttcggacctgagcaacctcaagtcccag
agcttgaacgagaggcgcacagccttgcactcgttggaaaggctccagcaggaggtggta
aagctgtgggttgagctccacgtgtccaacggctccacgtgtaacacgtgccccgagaac
tgggtcaacttccagaggaaatgctactacttcggcgagggcgccaagaagtggatccag
gcccggtttgcctgcagcaaactgcaagggcggctggtcagcatccacagccaagaggag
caggacttcctggccaaacgcgccaacaggaagggcacctggattggccttcgggacctg
gacatagagggggagtttatctggatggatgagaaccccctgaactacagcaactggcgg
ccgggggaacccaacaaccagggccagggcgaggactgtgtgatgatgcagggctccggg
cagtggaacgatgccttctgtggcagccggctggacggctgggtgtgtgaccggctggcc
acatgctga

DBGET integrated database retrieval system