KEGG   Felis catus (domestic cat): 101097411
Entry
101097411         CDS       T02385                                 
Symbol
GYPC
Name
(RefSeq) glycophorin-C
  KO
K06576  glycophorin C
Organism
fca  Felis catus (domestic cat)
Pathway
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101097411 (GYPC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101097411 (GYPC)
CD molecules [BR:fca04090]
 Proteins
  101097411 (GYPC)
SSDB
Motif
Pfam: Protocadherin Syndecan Adeno_E3_CR2 m04gp34like UL41A DUF4342
Other DBs
NCBI-GeneID: 101097411
NCBI-ProteinID: XP_003990737
LinkDB
Position
C1:complement(114515362..114558384)
AA seq 98 aa
MSSLNSTLPPDQEMVDSDHIFMTLGVNIAIIAGVITAIAIILICLLVITLRYLYGHKGTY
HTNEAKGTEFAESADAALQDDLSLQDTGGDSSRKEYFI
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagcagtctcaacagcacgttgccgcccgaccaagaaatggtcgactctgaccacatt
ttcatgacgttgggtgtgaacatcgccatcattgcaggcgtgatcacagcgatagccatc
atcctgatttgcctgcttgtcatcactctacgctacttgtacgggcacaagggcacctac
cacaccaatgaggccaagggcacagagtttgccgaaagtgcagatgcagccctgcaggat
gacctctccctccaggacacaggtggggacagcagcagaaaggagtactttatctga

DBGET integrated database retrieval system