KEGG   Felis catus (domestic cat): 101097909
Entry
101097909         CDS       T02385                                 
Symbol
HOXD10
Name
(RefSeq) homeobox protein Hox-D10
  KO
K09295  homrobox protein Hox-D10
Organism
fca  Felis catus (domestic cat)
Pathway
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101097909 (HOXD10)
   05205 Proteoglycans in cancer
    101097909 (HOXD10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101097909 (HOXD10)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    101097909 (HOXD10)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 101097909
NCBI-ProteinID: XP_003990937
Ensembl: ENSFCAG00000006264
UniProt: M3W5K7
LinkDB
Position
C1:166878442..166889107
AA seq 410 aa
MSLLSVLTRPAGRALEHVTCEEAAAQGHFQISLAWLSCGRQRHPQLHGECFPRDVSLQRT
QSLFFKFLPKMSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQT
CGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEE
SNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSP
EGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERS
CLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtcgctgttgtccgtgcttacgcggccggccggccgggctctggagcacgtgacctgc
gaggaggctgcggctcaaggccattttcaaatctcattggcttggttgtcatgtggtcgg
cagaggcatccacaattacacggggaatgttttcctagagatgtcagcctacaaaggaca
caatctctcttcttcaaattcctccccaaaatgtcctttcccaacagctctcctgctgct
aatacttttttagtagattccttgatcagtgcctgcaggagtgacagtttttattcgagc
agcgccagcatgtacatgccaccacctagcgcagacatggggacctatggaatgcaaacc
tgtggactgctcccgtctctggccaaaagagaagtgaaccaccaaaatatgggtatgaat
gtgcatccttatatacctcaagtagacagttggacagacccgaacagatcttgtcgaata
gagcaacctgttacacagcaagtccccacttgctccttcaccaccaacattaaggaagaa
tccaattgctgcatgtattctgataagcgcaacaaactcatttctgctgaggtcccttcg
taccagaggctggtccctgagtcctgtcccgttgagaaccccgaggttcctgtccctgga
tattttagactgagtcagacctacgccaccgggaaaacccaagagtacaataacagcccc
gaaggcagctccacagtcatgctccagctcaaccctcgcggcgcggccaagccgcagctc
tcggccgcccagctgcagatggaaaagaagatgaacgagcctgtgagcggccaggagccc
accaaagtctcccaggtggagagccccgaggccaagggcggccttccggaagaaaggagc
tgcctggctgaggtctccgtgtccagtcccgaagtacaggagaaggaaagcaaagaggaa
atcaagtctgatactccaaccagcaactggctcactgcaaagagtggcagaaagaagagg
tgcccttacactaagcaccaaacgctggaattagaaaaagagttcttgttcaatatgtac
ctcacccgcgagcgccgcctagagatcagtaagagcgttaacctcaccgacaggcaggtc
aagatttggtttcaaaaccgccgaatgaaactcaagaagatgagccgagagaaccggatc
cgagaactgaccgccaacctcaccttctcttag

DBGET integrated database retrieval system