KEGG   Felis catus (domestic cat): 101097963
Entry
101097963         CDS       T02385                                 
Name
(RefSeq) lipopolysaccharide-binding protein
  KO
K05399  lipopolysaccharide-binding protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101097963
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101097963
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101097963
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101097963
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101097963
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101097963
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101097963
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP PHA_gran_rgn
Other DBs
NCBI-GeneID: 101097963
NCBI-ProteinID: XP_003983522
Ensembl: ENSFCAG00000004811
LinkDB
Position
A3:complement(21623080..21647512)
AA seq 481 aa
MRALAGALPSLLLRLLLTSSPEALGANPGLVARITDKGLEYVAHEGLVTLREELLRITLP
DFTGDFKIKPFGRGHYEFHSLQIHSCELPGSTLTPLPGQGLSFTISDSFIRVQSEWKVRK
SFVKLHGSLDVEVKGITISVNLLLGRELSGRPTVSATSCSSHIQDVEVDVSGDLGWLLNL
FDNQIESKLRKALENKICERIQKSVASDLQPYLQTLPVTTEIDSFAGIDYSLTEAPRATA
QMLDVMFKGEIFNRDHYSPVTFLAPVMSLPEEHNRMVYFAISDYVFNTASRVYHEAGHLN
FSITDDMVPSGSTIRLTTKSFRPFAPRLARMYPNMNLELQGTMASAPFLNLSPGNLSLTP
QMEIEGFVLLPSSVREPVFRLGVTTNVSAMLTFNTSKITGALKPGKVQVELKESKVGVFN
VELLEALLNYHILHTLYPQVNEKLAEGFPLPLLKRIQLYDPVLEIHKDFLFLGANVQYMR
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgagggccttggccggggccctgccctctctactgctgaggctgctgcttacatcctcc
cctgaggccctgggtgccaaccccggcctggtcgccaggatcactgacaagggactagag
tacgtggcccacgagggattggtgaccctgcgggaggaactgctcagaatcacactgcct
gacttcaccggggacttcaagatcaagcccttcggccgtgggcactacgagttccatagc
ctgcagatccacagctgtgagctgcctggctccactctgacaccccttcccggccagggc
ctgagtttcaccatctctgactccttcatcagagtccagagcgaatggaaggtgcgcaaa
tctttcgtgaaactacacggctcccttgatgtggaggtcaagggcattaccatttcagtc
aaccttctcttgggcagagagctctctgggaggcccactgtcagtgccaccagctgcagc
agccacattcaagatgtggaggtggacgtgtcgggagacttggggtggctgttgaatctc
ttcgacaaccagattgagtccaagttacgcaaagcgttggaaaacaagatttgcgaaagg
atccagaaatcggtggcctctgacctacagccgtatctccaaactctgccagtcacaaca
gagatcgacagtttcgctggcatcgattacagtttaacggaagcccctcgggcaacagcc
caaatgctggacgtgatgtttaagggtgaaatttttaaccgcgatcactattccccagtc
accttccttgctcctgtcatgagtcttcctgaggagcacaaccgaatggtctactttgcc
atctctgattatgtcttcaacacagccagtcgggtttatcacgaggcagggcacctgaac
ttctccatcacagatgacatggttccttctggctctactatccggctgaccaccaagtcc
ttccgccccttcgcgccccggttagccagaatgtaccccaacatgaacttggagctccag
ggaacaatggcctcagccccattcctgaacctcagccctgggaatctgtccttgaccccc
cagatggagattgaaggctttgtgctcctgcccagctccgtcagggagcctgtgttcagg
cttggtgtgactaccaatgtgtctgccatgttgaccttcaacaccagcaagatcactggg
gccctgaagccaggaaaggtgcaagtggaactgaaagaatctaaagtcggagtattcaat
gtggagctgttggaggcgctgctcaactaccacattctccacaccctctaccctcaggtc
aacgagaagttggcagaaggcttccccctccctctgctgaagcgcattcagctctatgac
cctgttctcgagatccacaaggacttcctgttcctaggtgccaatgtccagtacatgaga
gtttga

KEGG   Felis catus (domestic cat): 109498011
Entry
109498011         CDS       T02385                                 
Name
(RefSeq) lipopolysaccharide-binding protein-like
  KO
K05399  lipopolysaccharide-binding protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109498011
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109498011
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109498011
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109498011
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    109498011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    109498011
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109498011
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Other DBs
NCBI-GeneID: 109498011
NCBI-ProteinID: XP_023107026
LinkDB
Position
A3:complement(21565822..21587865)
AA seq 374 aa
MSVSGNWKVKKAFITLDGTFDVRVDGISISVSLNLGKDQSGRPTASVAHCSNSIGHVSVD
ISGSLSWILNLFHKRIENNFKNILEQKICEMVRKSTASHLEPYLRTLPVIAMIDQVAGID
YSLVGAPQVTSQVIDTPFKGEFFGRNWRSPAPFDAPPIRLPEKQDHPVYFAVSEYVFNTA
SRVYHQAGRMNFTIQNQHIPQDSPIRLHTNSFRAIIPQLARLYPNTELELETSPESAPFL
MFTPGNVTLSPVIDIQAFALLPTSSERKLLFELRVTTNISATINVSSGRIVGSVTTGSKL
KLELKHSNIRYFNVDLMEAILNYYALHTLYPSLNAKLEEGFPLPLPRDTYLNSLELHVHK
NFLLLGANLEEAEH
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtctgtcagcgggaactggaaggtgaaaaaggctttcatcaccctcgatggtactttc
gacgtgcgtgtggatggcatttccatctcggtttccctgaacttgggcaaggaccagtct
ggacgacccactgcctctgtggcccactgcagcaactccattggccacgtcagcgtcgac
atttctggatctctaagctggatcctgaacctcttccataaaagaattgaaaacaatttc
aaaaacatcttggaacaaaagatctgcgaaatggtccggaagtcaacagcctctcacctg
gagccctatctccggacgctgccagtcatcgccatgattgaccaggttgccggcattgac
tacagcttagtaggagctccccaagtgacttctcaagtcatagacacacccttcaagggt
gaattctttggccgaaactggcgctccccagcccccttcgatgctcctcccatcaggctg
cctgagaagcaggaccacccggtctactttgctgtctccgagtatgtcttcaacacagcc
agccgggtttaccaccaggctgggcgcatgaatttcaccatccaaaaccagcacattccc
caggactctccaatccgcctgcacaccaactcattccgggccattattcctcagctggcc
aggttgtaccccaatacggagctagagcttgagacgtctcccgaatcggccccgttcctg
atgttcacccctggaaatgtgaccctcagtccagtgatagacatccaggccttcgctctc
ctgcccacctcctctgagcgcaagctactcttcgaactcagggtgacaaccaacatctcc
gccaccatcaatgtgagctccggcaggatcgttggttcggtgaccacgggcagtaagctg
aaattggaactgaaacactccaacatccgttacttcaacgtggatctgatggaagccatc
ctcaattactacgcgctgcacaccctgtacccctctctcaacgcaaagcttgaggagggc
ttccctctgcctctgccaagggacacctacctcaacagtttggagctccacgtccacaag
aacttcttgctcttgggggccaaccttgaagaggccgaacactga

DBGET integrated database retrieval system