KEGG   Felis catus (domestic cat): 101098453
Entry
101098453         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05012  Parkinson disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05034  Alcoholism
fca05142  Chagas disease
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101098453
   04020 Calcium signaling pathway
    101098453
   04072 Phospholipase D signaling pathway
    101098453
   04024 cAMP signaling pathway
    101098453
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101098453
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101098453
  09152 Endocrine system
   04911 Insulin secretion
    101098453
   04922 Glucagon signaling pathway
    101098453
   04923 Regulation of lipolysis in adipocytes
    101098453
   04912 GnRH signaling pathway
    101098453
   04913 Ovarian steroidogenesis
    101098453
   04915 Estrogen signaling pathway
    101098453
   04921 Oxytocin signaling pathway
    101098453
   04926 Relaxin signaling pathway
    101098453
   04935 Growth hormone synthesis, secretion and action
    101098453
   04918 Thyroid hormone synthesis
    101098453
   04928 Parathyroid hormone synthesis, secretion and action
    101098453
   04916 Melanogenesis
    101098453
   04924 Renin secretion
    101098453
   04925 Aldosterone synthesis and secretion
    101098453
   04927 Cortisol synthesis and secretion
    101098453
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101098453
   04270 Vascular smooth muscle contraction
    101098453
  09154 Digestive system
   04970 Salivary secretion
    101098453
   04971 Gastric acid secretion
    101098453
   04972 Pancreatic secretion
    101098453
   04976 Bile secretion
    101098453
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101098453
   04961 Endocrine and other factor-regulated calcium reabsorption
    101098453
  09156 Nervous system
   04724 Glutamatergic synapse
    101098453
   04728 Dopaminergic synapse
    101098453
   04726 Serotonergic synapse
    101098453
   04730 Long-term depression
    101098453
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101098453
  09159 Environmental adaptation
   04713 Circadian entrainment
    101098453
   04714 Thermogenesis
    101098453
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098453
   05207 Chemical carcinogenesis - receptor activation
    101098453
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101098453
   05165 Human papillomavirus infection
    101098453
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101098453
   05142 Chagas disease
    101098453
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101098453
  09165 Substance dependence
   05030 Cocaine addiction
    101098453
   05031 Amphetamine addiction
    101098453
   05032 Morphine addiction
    101098453
   05034 Alcoholism
    101098453
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101098453
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098453
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101098453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101098453
   04031 GTP-binding proteins [BR:fca04031]
    101098453
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101098453
  Exosomal proteins of other body fluids (saliva and urine)
   101098453
  Exosomal proteins of colorectal cancer cells
   101098453
  Exosomal proteins of bladder cancer cells
   101098453
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    101098453
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_29
Other DBs
NCBI-GeneID: 101098453
NCBI-ProteinID: XP_023106831
LinkDB
Position
A3:complement(4611148..4665723)
AA seq 969 aa
MGVRNCLDGNNMSGQRDIPLELGEQPEQPPLEAPGAAAPSPGPGAAEEMETEPPHSEPVP
LEIEGEACGPPEVSGPNCQDLGQAIEETRALGGYSPPPEEAMPFEVEQPSPGGFWPTLEQ
PGDTTGAHAGPEVFSPTVMEPGAFDDARPGLGGYSPPPEEAMPFEFEQPAQGGCSQPLLQ
VSDLAPGGPGAGVFSTPPQEPGALKPATTGFRGDCSPPPEEAMPFEFDGAAFGDDSPPPG
LPRAIPQIDGGSIGQPAAVAVPSAVLLAPAANEPPLWVPGAIGSPSREAVRSPPHFAGDS
PPMEISGPPLEIGSAPVGVDDAPVNMDSPPIALDGPPIEVSGAPVKRERAEGERPPVEGE
AAEMEGGSAAASAAGRGKVPSPGDGAPAAGADRASPAAGAAPAAPAAPAAGAAAAAPAAP
AAGAAPAARAAPAAPAAPAAGAAPAARAAPAAPASGARPKLRFLRPPSPEIQAADPPTPQ
PTRAFAWRGRSGRGRDDDERSVSSDDDHSSDESDDGTSGCRRWLQPRRNRRRRKPRRNLL
RKFLMQAFGGCFGRSESPQPKAAPSPKVKKIPLAEKRRQMRKEALEKRAQKRAEKKRSQL
IDKQLQEEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
GEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPE
FYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTS
GIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNR
LQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDAT
PEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQR
MHLRQYELL
NT seq 2910 nt   +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaataatatgtcaggacaacgcgatatccccctt
gaactcggggaacagcccgagcaaccacccttggaggccccaggggcagctgcccccagt
cctgggcctggcgcagccgaagagatggagaccgaaccgcctcacagcgagcccgtcccc
ctcgagattgaaggcgaggcctgtggaccccccgaggtctccggacccaactgccaggac
ctgggccaggccatcgaggaaaccagagccctcggaggctacagcccacctcctgaggaa
gccatgcccttcgaggtcgagcagcccagcccaggaggcttctggcctaccctggagcag
cccggagacaccactggggcccatgcaggccctgaggtcttcagcccaacggtcatggag
cccggagccttcgatgatgccagacccggcctgggaggctacagccctccacctgaagaa
gccatgccctttgagtttgagcagcctgcacagggaggttgcagccagcctctcctgcag
gtctcagacctcgctccaggaggcccaggtgcaggggtcttcagcactcctccccaggag
cctggagccctcaagcctgcaaccacaggcttcagaggagactgtagtcctccccctgag
gaggctatgccatttgagtttgatggagcagcctttggggacgacagcccaccccccggg
ctcccccgagctatcccacaaatcgacggcggcagcatcggccagcccgcggcagtcgcg
gtcccgagtgcggtcctcctcgctcccgccgcgaacgagccccccctctgggtccccggc
gccatcggcagcccatcccgagaggctgtcagatctcctccacacttcgcgggcgacagc
cccccgatggagatctccggacccccgctcgagattggcagcgcccccgttggggtcgac
gacgctcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatcgaggtc
tccggagccccagttaagagagagcgagcagagggagagagacccccagttgagggagaa
gcagccgagatggaaggaggctcagccgccgcctctgctgcggggagaggaaaagtcccc
tctcccggggacggagccccagcggccggggccgaccgtgcttctccagccgccggggca
gccccagccgcccctgccgctccagccgccggggcagccgctgccgcccctgccgctccg
gccgccggggcagctccagccgccagggcagctcctgccgcccctgccgctccggccgcc
ggggcagctcctgccgcccgggcagcccctgccgcccctgcgtctggagcccgacccaag
ctccgcttcctccgaccccccagccccgagatccaggctgccgatccgcctactccgcag
cctactcgcgcatttgcctggcggggcaggtctggccgcggccgcgacgacgacgagagg
tcggtcagcagcgacgacgaccacagcagcgatgaatccgacgatgggacctccggatgc
cgccgctggctgcagccccggcgaaatcgccgccgccgaaagccccggcgcaacttgctc
cgcaagttcctcatgcaggccttcgggggctgcttcggccgatccgagagcccccagccc
aaagccgcccccagccccaaggtcaagaagattcccctggcggagaagcgcagacagatg
cgcaaggaagccctggagaagcgcgcccagaagcgcgcagagaagaaacgcagccagctc
atcgacaaacaactccaggaagaaaagatggggtacatgtgtacgcaccgcctgctgctt
ctaggtgctggagaatctggtaaaagcaccattgtgaagcaaatgaggattctgcatgtt
aatgggtttaatggagagggcggcgaagaggacccgcaggctgccaggagcaacagcgat
ggtgagaaggcaaccaaagtgcaggacatcaaaaacaacctgaaagaggccatcgaaacc
atcgtggccgccatgagcaacctggtcccccccgtggagctggccaaccctgagaaccag
ttcagagtggactacattctgagcgtgatgaacgtgcccgacttcgacttccctcccgag
ttctacgagcacgccaaggctctgtgggaggacgaaggagtgcgtgcctgctatgagcgc
tccaacgagtaccagctgattgactgcgcccagtacttcctggacaagatcgatgtcatc
aagcaggctgactacgtgcccagtgaccaggatctgcttcgctgccgcgtcctgacttct
ggaatctttgagaccaagttccaggtggacaaagtcaacttccacatgttcgacgtgggt
ggccagcgtgacgagcgccgcaaatggatccagtgcttcaacgatgtgactgccattatc
ttcgtggtggccagcagcagctacaacatggtcattcgggaggacaatcagaccaaccgc
ctgcaggaggctctgaacctcttcaagagcatctggaacaacagatggctgcgcaccatc
tccgtgatcctgttcctcaacaagcaagacctgctcgctgagaaagtcctcgctggaaaa
tcgaaaattgaggactactttccagaatttgctcgctacactactcccgaggatgctact
cccgagcccggagaggacccacgcgtgacccgggccaagtacttcatccgcgacgaattt
ctgagaatcagcactgccagtggagacgggcgtcactactgctatccccacttcacttgc
gccgtggacaccgagaacatccgccgtgtgttcaacgactgccgtgacatcattcagcgc
atgcaccttcgtcagtacgagctgctctaa

KEGG   Felis catus (domestic cat): 102900772
Entry
102900772         CDS       T02385                                 
Name
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05012  Parkinson disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05034  Alcoholism
fca05142  Chagas disease
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102900772
   04020 Calcium signaling pathway
    102900772
   04072 Phospholipase D signaling pathway
    102900772
   04024 cAMP signaling pathway
    102900772
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102900772
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102900772
  09152 Endocrine system
   04911 Insulin secretion
    102900772
   04922 Glucagon signaling pathway
    102900772
   04923 Regulation of lipolysis in adipocytes
    102900772
   04912 GnRH signaling pathway
    102900772
   04913 Ovarian steroidogenesis
    102900772
   04915 Estrogen signaling pathway
    102900772
   04921 Oxytocin signaling pathway
    102900772
   04926 Relaxin signaling pathway
    102900772
   04935 Growth hormone synthesis, secretion and action
    102900772
   04918 Thyroid hormone synthesis
    102900772
   04928 Parathyroid hormone synthesis, secretion and action
    102900772
   04916 Melanogenesis
    102900772
   04924 Renin secretion
    102900772
   04925 Aldosterone synthesis and secretion
    102900772
   04927 Cortisol synthesis and secretion
    102900772
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102900772
   04270 Vascular smooth muscle contraction
    102900772
  09154 Digestive system
   04970 Salivary secretion
    102900772
   04971 Gastric acid secretion
    102900772
   04972 Pancreatic secretion
    102900772
   04976 Bile secretion
    102900772
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102900772
   04961 Endocrine and other factor-regulated calcium reabsorption
    102900772
  09156 Nervous system
   04724 Glutamatergic synapse
    102900772
   04728 Dopaminergic synapse
    102900772
   04726 Serotonergic synapse
    102900772
   04730 Long-term depression
    102900772
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102900772
  09159 Environmental adaptation
   04713 Circadian entrainment
    102900772
   04714 Thermogenesis
    102900772
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102900772
   05207 Chemical carcinogenesis - receptor activation
    102900772
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102900772
   05165 Human papillomavirus infection
    102900772
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102900772
   05142 Chagas disease
    102900772
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102900772
  09165 Substance dependence
   05030 Cocaine addiction
    102900772
   05031 Amphetamine addiction
    102900772
   05032 Morphine addiction
    102900772
   05034 Alcoholism
    102900772
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102900772
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102900772
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102900772
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    102900772
   04031 GTP-binding proteins [BR:fca04031]
    102900772
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102900772
  Exosomal proteins of other body fluids (saliva and urine)
   102900772
  Exosomal proteins of colorectal cancer cells
   102900772
  Exosomal proteins of bladder cancer cells
   102900772
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    102900772
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 102900772
NCBI-ProteinID: XP_006929663
Ensembl: ENSFCAG00000016337
UniProt: M3WND3
LinkDB
Position
A3:complement(4625930..4679477)
AA seq 247 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPEPPESDHEHEEADLELSLPECLEYEEEFDYESESETETESEIE
SETDFETEPETAPATEPETEPEDERGPVVPKHTTFGQSLTERLHALRLRSPDASPSRAQP
STQEPQNPRQGEEPEPEDKDPRDPEESEEPKEEEKKQQRRCKPKKPTRRDPSPESPSKRG
PIPIRRH
NT seq 744 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcagcagtggcgccgagctcgccacaactacaacgatctg
tgcccacctatcggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgcgcccagcagcgcgcggccgcccagcag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggtgttccccgagcccccc
gaatctgaccacgagcacgaggaggcagacctcgagctgtccctccccgagtgcctagag
tacgaggaagagtttgactacgaatccgagagcgagaccgagaccgagtctgaaatcgaa
tccgagaccgacttcgagaccgagcctgagaccgcccccgccactgagcccgagaccgag
cccgaggacgagcgcggccccgtggtgcccaagcacaccaccttcggccaatctctcacc
gagcgtctgcacgctctgagattgcggagccccgacgcctccccgagtcgcgcgcagccc
agcactcaggagccccagaaccccaggcagggggaggagcccgagcccgaggacaaggat
ccgagggaccccgaggagtccgaggagccaaaggaggaggagaagaagcagcagcgccgc
tgcaagccgaagaagcccacccgccgcgacccatccccggagtccccttccaaaagggga
cccatccccatccggcgtcactaa

DBGET integrated database retrieval system