KEGG   Felis catus (domestic cat): 101098525
Entry
101098525         CDS       T02385                                 
Symbol
RFXANK
Name
(RefSeq) DNA-binding protein RFXANK isoform X1
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101098525 (RFXANK)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101098525 (RFXANK)
  09163 Immune disease
   05340 Primary immunodeficiency
    101098525 (RFXANK)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank Ank_4
Other DBs
NCBI-GeneID: 101098525
NCBI-ProteinID: XP_006928719
Ensembl: ENSFCAG00000009775
UniProt: M3WC37
LinkDB
Position
A2:14215528..14222209
AA seq 260 aa
MEPTQPAEDLSLTQQLPIPEFGDPEDPSDEAPDGSDTVVLSLFPCTLEPGNPEPDAGASS
PQGGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKEHLRKGDNLINKP
DEHGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASMGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
NT seq 783 nt   +upstreamnt  +downstreamnt
atggagcccacccagccggcagaggacctcagtctgacccaacagctccccatcccagaa
tttggggaccctgaggaccccagcgatgaggcccccgatggctcagacactgtggtgctc
agtctcttcccctgcactctggagcctgggaatcctgaaccggatgctggtgcctcctca
ccgcagggaggcagctccctgaagcactccacaaccctcaccaaccggcagcgggggaac
gaggtttcggccctgccagccaccctcgactccctgtccatccaccagctcgcggcccag
ggggagctgagccagctgaaggaacatctgaggaaaggcgacaacctcatcaacaagccg
gacgagcatggcttcacccccctcatctgggcctccgcctttggagaaatcgagactgtc
cgcttcttgctcgagtggggtgctgacccccacatcctggccaaggaacgggaaagcgcc
ctgtccctggccagcatgggcggctacacagacattgtagggctgctacttgagcgtgac
gtggacatcaacatctacgactggaatggagggacgccactgctgtacgccgtgcgtggg
aaccacgtgaagtgcgtagaagccttgttggcccgaggagccgatctcaccactgaggct
gactccggctataccccaatggaccttgccgtggccctgggatatcggaaagtgcaacag
gtgatcgagaaccacatcctcaaactcttccagagcaacctggtgcccgcagatcctgag
tga

DBGET integrated database retrieval system