KEGG   Felis catus (domestic cat): 101098744
Entry
101098744         CDS       T02385                                 
Symbol
CD44
Name
(RefSeq) CD44 antigen isoform X9
  KO
K06256  CD44 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04512  ECM-receptor interaction
fca04640  Hematopoietic cell lineage
fca05169  Epstein-Barr virus infection
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101098744 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101098744 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101098744 (CD44)
   05205 Proteoglycans in cancer
    101098744 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101098744 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101098744 (CD44)
   04090 CD molecules [BR:fca04090]
    101098744 (CD44)
   00535 Proteoglycans [BR:fca00535]
    101098744 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101098744 (CD44)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101098744 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   101098744 (CD44)
  Exosomal proteins of colorectal cancer cells
   101098744 (CD44)
  Exosomal proteins of bladder cancer cells
   101098744 (CD44)
CD molecules [BR:fca04090]
 Proteins
  101098744 (CD44)
Proteoglycans [BR:fca00535]
 Cell surface proteoglycans
  Others
   101098744 (CD44)
Glycosaminoglycan binding proteins [BR:fca00536]
 Hyaluronan
  Cell surface receptors
   101098744 (CD44)
SSDB
Motif
Pfam: Xlink VP4_2
Other DBs
NCBI-GeneID: 101098744
NCBI-ProteinID: XP_011285110
LinkDB
Position
D1:90920013..91011461
AA seq 661 aa
MDKFWWRLAWGLCLSQLSLAQIDLNITCRYAGVFHVEKNGRYSISKTEAADLCKAFNSTL
PTMTEMEAALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPGEDCTSVTHLPNAFEGPITITIVNRDGTRYTQTGEYRTNPEDIYPSNPTDDDVSS
GSSSERSTSGGYSIFHTHLPTAYPTQDQDSPGTSDNPENPPITSTDSNIISAGWEPTEEN
EDERDKHPSYSGSGIDDDEDFISSTISTTPRLFNHPKQNQDRTQWSPGESSPGVLLQTTA
RMTDVDRSSTIANGESWTREPHSPLIHHERHDEEETQHSMSPTPAHDSHPDQRMTTQSQE
DSSWTYFFDPISHPMGRGHQTERWMDLDSSHSTTLQPSADPNTHSVEELDRTGPLSVTTQ
QSHTQSFSTSHGDWEEDKDHPVTSTPTSSSKDDRTDGKGGRRSGHLPEDSATSVESSTSR
SPATKELRTLIPVTPAKTGVPEVTEVNIAGDSDSNVDRFFSEDQDSPVHPSGRSHTTHGS
ESAGHTSGSQEGGANTTSGPTRKPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKK
LVINNGNGAVEERKASGLNGEASKSQEMVHLVNKESSVTCDQYMTADETRNLQNVDMKIG
V
NT seq 1986 nt   +upstreamnt  +downstreamnt
atggacaagttttggtggcgcctagcctggggactgtgcctctcgcagttgagcctggcg
cagatcgatttgaatataacctgccgatacgcgggtgtgttccacgtggagaaaaacggt
cgctacagcatctcgaagacggaggctgctgacctctgcaaggctttcaacagcaccctg
cccaccatgaccgagatggaggcagccctgagcatcgggtttgagacctgcaggtacggg
ttcatagaaggtcacgtggtgatcccccgtattcaccccaactccatctgtgccgcgaac
aacactggggtgtacatcctcacatccaacacctcccagtatgacacgtactgctttaat
gcctcagctccgcctggagaagattgtacatcggtcacacacctgcccaatgcctttgaa
ggaccaattaccataaccattgttaaccgtgatggcacccgctatacccagacgggtgaa
tacagaactaaccctgaagacatctaccccagcaaccccactgacgatgacgtgagcagt
ggatcgtccagtgaaagaagcacttcaggaggctacagcattttccacacccaccttcca
actgcctacccgacccaggaccaagacagtcccgggacgtccgacaacccagagaatccc
cccatcaccagtacggattcaaatatcatctcagcaggctgggaaccaactgaagaaaac
gaagatgaaagagacaaacaccccagttattctggatcaggcattgatgatgatgaagat
tttatctccagtaccatttcaaccacaccacggctttttaaccacccaaaacagaaccag
gatcggacccaatggagcccaggcgaatcgagtccaggagtgttacttcagacaactgcg
aggatgactgatgtggacagaagcagcaccattgctaatggagaaagctggacccgcgaa
ccacactctcctctcattcaccatgagcgtcacgatgaagaggagacccagcattctatg
agcccaaccccggcccatgacagccatccagaccaaagaatgacaacgcagagtcaagag
gacagctcctggacttacttcttcgacccaatctcacatccaatgggacgaggtcatcaa
acagaaagatggatggatctggactccagccatagtacaacacttcaaccttctgcagat
ccaaacacacattcggtggaagagttggacaggacaggacctctttccgtgacgactcag
cagagtcatactcagagcttctctacatcacatggagactgggaagaagataaagaccat
ccagtgacttctactccaacatctagcagtaaggatgataggactgatggcaaaggtgga
agaagaagtggacatcttcctgaagactcagctacttcagtggaaagttctacttctcgg
tccccagccacaaaggaactcaggaccctcatcccagtgacccctgctaagacgggggtc
cctgaagttactgaagttaatattgctggagattccgactctaatgttgatcgtttcttt
tcagaagaccaagactcgccagttcaccccagtgggaggtcccatacgactcatggatca
gaatcagctgggcacacaagtggaagtcaagaaggtggggcgaacacgacctccggtcct
acgcggaaacctcaaattccagaatggctcatcatcttggcctccctcctggccttggct
ttgattcttgccgtctgcattgccgtcaatagtcgaagaaggtgtgggcagaagaaaaag
ctggtaatcaacaacggtaatggagcagtggaggagagaaaggcaagtggactcaacgga
gaagccagcaagtctcaggagatggtgcacttggtgaacaaggagtcctcagtgacctgc
gatcagtatatgacagccgatgagacgcggaacctgcagaatgtggacatgaagattggg
gtgtag

DBGET integrated database retrieval system