KEGG   Felis catus (domestic cat): 101099249
Entry
101099249         CDS       T02385                                 
Symbol
PIK3C3
Name
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase catalytic subunit type 3
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04070  Phosphatidylinositol signaling system
fca04136  Autophagy - other
fca04140  Autophagy - animal
fca04145  Phagosome
fca04371  Apelin signaling pathway
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05022  Pathways of neurodegeneration - multiple diseases
fca05132  Salmonella infection
fca05152  Tuberculosis
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101099249 (PIK3C3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101099249 (PIK3C3)
   04070 Phosphatidylinositol signaling system
    101099249 (PIK3C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101099249 (PIK3C3)
   04140 Autophagy - animal
    101099249 (PIK3C3)
   04136 Autophagy - other
    101099249 (PIK3C3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101099249 (PIK3C3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101099249 (PIK3C3)
   05152 Tuberculosis
    101099249 (PIK3C3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101099249 (PIK3C3)
   05014 Amyotrophic lateral sclerosis
    101099249 (PIK3C3)
   05016 Huntington disease
    101099249 (PIK3C3)
   05017 Spinocerebellar ataxia
    101099249 (PIK3C3)
   05022 Pathways of neurodegeneration - multiple diseases
    101099249 (PIK3C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101099249 (PIK3C3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     101099249 (PIK3C3)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Macropinocytosis
   Kinases
    101099249 (PIK3C3)
  Rab GTPases and associated proteins
   Rab associated proteins
    101099249 (PIK3C3)
 Endosome - Lysosome transport
    101099249 (PIK3C3)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    101099249 (PIK3C3)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 HEAT_2
Other DBs
NCBI-GeneID: 101099249
NCBI-ProteinID: XP_003995198
Ensembl: ENSFCAG00000022869
UniProt: M3XFX9
LinkDB
Position
D3:64813478..64965017
AA seq 887 aa
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFEIVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQGSVSESVSNSGINSAEIDSSQIITSPLPPVSSPPPASKTKDSSDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgggagaagcggagaagtttcactacatctacagttgcgacctggacatcaacgtgcag
cttaagataggaagtttggaagggaagagagaacaaaagagttataaagccgttctagaa
gacccaatgttgaagttttcagggctgtaccaggagacatgctcagatctttatgttact
tgtcaagtttttgcagaagggaagcctctggccttgccagtgagaacatcctacaaagca
tttagtacaagatggaactggaatgaatggctaaaactgcctgtaaaatacccagacctg
cccaggaatgcccaagtggccctcactatatgggatgtgtatggaccagggaaggcagtg
cctgtgggaggaacaacggtttcgctctttggaaaatatggcatgtttcgccaagggatg
cacgacttgaaagtctggcctaatgtagaagcagatggatcagaacccacaaaaactcct
ggcagaacaagcagtactctctcagaagatcagatgagccgccttgccaagctcaccaaa
gctcatcgacaaggacacatggtgaaagtagactggctggacagattgacatttagagaa
atagaaatgataaatgagagtgaaaaacgaagttctaatttcatgtacctgatggttgag
tttcgatgtgtcaagtgtgatgataaggaatatggtattgtttattatgaaaaggatggt
gatgagtcatctccaattttaacaagctttgagatagtgaaggttcctgatcctcagatg
tctatggagaatttagttgagagcaaacatcacaagcttgcccggagtttaagaagtgga
ccttctgaccatgatctcaaacctaacgctgccacaagagatcaactaaatattattgtg
agttatccaccaaccaagcaacttacatatgaagaacaagatcttgtttggaagtttaga
tattatctcactaatcaagaaaaagctttaacaaaattcttgaaatgtgttaattgggat
ttacctcaggaggctaaacaggcattggaacttctaggaaaatggaagccaatggatgta
gaggactccttggagcttttatcctcccattacaccaatccaactgtgaggcgttatgct
gttgcccggttgcgacaggcagatgatgaggatttgttgatgtacctattacagctggtc
caggctctcaaatatgaaaattttgatgacataaagaatggattagaacctaccaagaag
gatagtcagggttcagtgtcagagagtgtgtcaaattctggaatcaattctgcagaaata
gatagctcccaaattataaccagccctcttcctccagtgtcttcccctcctcctgcatcc
aaaacaaaagacagttcagatggtgaaaatctagagcaagatctctgtaccttcttgata
tcaagagcctgcaaaaactcaacactggctaattatttatactggtatgtgatagtggaa
tgtgaagatcaggacactcagcagagagatccaaagacccatgagatgtacttaaatgta
atgagacgattcagccaagcattgttgaagggtgataagtctgtcagagttatgcgttct
ttactggctgctcagcaaacgtttgtagatcgtttggtgcatctaatgaaggcagtgcag
cgtgaaagcggaaatcgtaagaaaaagaacgagagactacaggcattgcttggagacaat
gaaaagatgaatttgtcagatgtggaacttatcccattgcctttagaaccccaggtgaaa
attagaggaataatcccagaaacagctacactatttaagagtgctcttatgcctgcacag
ttattttttaagacagaagatgggggcaaatacccagttatatttaagcatggggatgat
ttacgccaagatcaacttattcttcaaatcatttcactcatggacaagctgctacggaaa
gaaaatctggatttgaagttgacaccctacaaggtattagccactagtacaaaacatggc
ttcatgcagtttatccagtcagttcctgttgctgaagttcttgatacagaaggaagcatt
cagaacttctttagaaaatatgcaccgagtgagaatggaccaaatggaatcagtgctgaa
gttatggacacttatgttaaaagctgtgctggatattgcgtgattacatacatacttgga
gttggagacagacacctggataaccttttgctaacaaaaacaggcaaactcttccacata
gacttcggatatattttgggtcgggatccaaagcctcttcctcctccaatgaagctgaat
aaagaaatggtagaaggaatggggggcacccagagtgagcagtaccaagagtttcgtaaa
cagtgttacacggctttcctccaccttcgaaggtattctaacctgatattgaacttgttt
tccttgatggtggatgcaaacattccagatattgctcttgaaccagataaaactgtgaaa
aaggttcaggataaattccgactagacctgtctgatgaagaggccgtgcattacatgcag
agtctgattgatgaaagtgtccatgctctttttgctgcagtggtagaacagattcacaag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system