KEGG   Felis catus (domestic cat): 101099275
Entry
101099275         CDS       T02385                                 
Symbol
SKP2
Name
(RefSeq) S-phase kinase-associated protein 2 isoform X1
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04120  Ubiquitin mediated proteolysis
fca04150  mTOR signaling pathway
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101099275 (SKP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101099275 (SKP2)
   04150 mTOR signaling pathway
    101099275 (SKP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101099275 (SKP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099275 (SKP2)
   05203 Viral carcinogenesis
    101099275 (SKP2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101099275 (SKP2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101099275 (SKP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101099275 (SKP2)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     101099275 (SKP2)
SSDB
Motif
Pfam: F-box-like F-box F-box_5
Other DBs
NCBI-GeneID: 101099275
NCBI-ProteinID: XP_023094784
Ensembl: ENSFCAG00000001018
LinkDB
Position
A1:complement(212964548..212998378)
AA seq 436 aa
MHPFKTPELVDAMHRKHLQEIPDQGSNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDS
ENIPQELLSNLGHAQSPPRKRLKSKGNDKDFVIVRRPKLNRDSFPGVSWDSLPDELLLGI
FSCLCLPELLKVSSVCKRWYHLAFDESLWQTLDLTGKNLHPDVIGRLLSRGVVAFRCPRS
FVDQPLVEHFSSFRVQHMDLSNSVIDVSTLHGILSRCSKLQNLSLEGLQLSDPIVNNLAQ
NSNLLRLNLSGCSGFSESALKTLLSSCSRLDELNLSWCYDFTEKHVQVAVAHVSETVTQL
NLSGYRKNLQRSDVSTLVGRCPNLVHLDLSDSVMLKNDCFPEFYQLNYLQHLSLSRCYDI
IPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINTSHFTTIARPTTGNKKNQE
IWGIKCRLTLQKPSCL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcacccatttaaaactccagaacttgtggacgccatgcacaggaaacacctccaggag
attcctgaccagggtagcaacgttactaccagcttcacatggggatgggattctagcaag
acttctgaactgctgtcaggcatgggggtctccgccctggagaaagaggaggtggacagt
gagaatatcccccaggaactgctctcaaacctgggccacgctcagagccccccacgaaaa
cggctgaagagcaaggggaatgacaaggattttgtgatagtccgcagacctaagctaaat
agagacagctttccaggtgtttcatgggactcccttccggacgagctgctcttaggaatc
ttttcctgtctgtgcctccctgaactcttgaaggtctccagtgtttgtaagaggtggtat
cacctagcgtttgatgagtccctgtggcagaccttggacctcacaggtaaaaacctgcac
ccagatgtgatcggccggctgctgtctcgaggggtggttgccttccgctgcccacgatca
tttgtggatcaaccattagttgaacatttcagctctttccgtgtgcaacacatggatctg
tccaactctgtaatcgatgtgtctaccctccacggcattctgtcccggtgctccaagctg
cagaatctaagcctggaaggcctccagctgtcagatcccattgtcaataacctagcacag
aactcaaatttattgcgactaaatctttctgggtgttctggattctccgaatctgccctg
aagactttgctgagcagctgttccagattggatgagctgaacctctcctggtgttacgac
ttcactgagaagcacgtgcaagtggctgtcgcgcatgtgtcagagaccgtcacccagctg
aacctcagtggctaccgaaagaatctccagagatcagatgtctctaccttagttggaaga
tgccccaatcttgtccacctagacttaagtgatagtgtcatgctgaagaatgactgcttt
ccagaattttaccagctcaactacctccaacatctgtcactcagtcgatgctatgatatc
atacctgaaactttacttgaacttggagaaattcccacactaaaaacactacaagttttt
ggaatcgtgccagacggtacccttcaactgttaaaagaagcccttcctcatctacagatt
aatacttcccatttcaccaccattgccaggccgaccactggcaacaaaaagaaccaggag
atatggggcatcaaatgccggctgacactgcaaaagcccagttgtctatga

DBGET integrated database retrieval system