KEGG   Felis catus (domestic cat): 101099589
Entry
101099589         CDS       T02385                                 
Symbol
PPIF
Name
(RefSeq) peptidyl-prolyl cis-trans isomerase F, mitochondrial isoform X5
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04613  Neutrophil extracellular trap formation
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05145  Toxoplasmosis
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101099589 (PPIF)
   04022 cGMP-PKG signaling pathway
    101099589 (PPIF)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101099589 (PPIF)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101099589 (PPIF)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101099589 (PPIF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101099589 (PPIF)
   05012 Parkinson disease
    101099589 (PPIF)
   05016 Huntington disease
    101099589 (PPIF)
   05017 Spinocerebellar ataxia
    101099589 (PPIF)
   05020 Prion disease
    101099589 (PPIF)
   05022 Pathways of neurodegeneration - multiple diseases
    101099589 (PPIF)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101099589 (PPIF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101099589 (PPIF)
Enzymes [BR:fca01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101099589 (PPIF)
Chaperones and folding catalysts [BR:fca03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101099589 (PPIF)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 101099589
NCBI-ProteinID: XP_003994158
Ensembl: ENSFCAG00000025543
UniProt: M3XFI8
LinkDB
Position
D2:41375386..41382136
AA seq 204 aa
MLALRCGPRLLGLLRVPRSAPLRLPAARACSGAGDPSPSSRNPLVYLDVGADGEPLGRVV
LELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGS
RFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKK
IESFGSRSGKTSKKIVITDCGQLS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcttgctctacgctgcggcccccgcctgctcggcctgctccgggtcccgcgctccgcg
ccgctgcgcctccccgcggcccgcgcctgcagcggcgccggcgacccgtccccttcctcc
cggaacccgctcgtgtacctggacgtgggcgccgacggggagccgctcggccgcgtggtg
ctggagctgaaggcagatgtcgtcccgaagacagcagagaacttcagagccctgtgtacc
ggggagaagggcttcggctacaaaggctccacctttcacagagtgattccgtccttcatg
tgccaggcgggcgacttcaccaaccacaatggcaccgggggaaagtccatctacggaagc
cgctttcctgatgagaacttcacactgaagcacgtgggaccaggtgtcctctccatggcg
aatgcaggccccaacaccaacggctcccagttcttcatctgcaccataaagacagactgg
ttggatggcaagcatgttgtgtttggccatgtcaaagagggcatggatgtcgtgaagaaa
atagaatctttcggttccaggagtgggaagacgtccaagaagatcgtcatcacagactgc
ggccagttgagctga

DBGET integrated database retrieval system