KEGG   Felis catus (domestic cat): 101099650
Entry
101099650         CDS       T02385                                 
Symbol
CCR8
Name
(RefSeq) C-C chemokine receptor type 8
  KO
K04183  C-C chemokine receptor type 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099650 (CCR8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099650 (CCR8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101099650 (CCR8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101099650 (CCR8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101099650 (CCR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101099650 (CCR8)
   04050 Cytokine receptors [BR:fca04050]
    101099650 (CCR8)
   04090 CD molecules [BR:fca04090]
    101099650 (CCR8)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101099650 (CCR8)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   101099650 (CCR8)
CD molecules [BR:fca04090]
 Proteins
  101099650 (CCR8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 101099650
NCBI-ProteinID: XP_023094341
Ensembl: ENSFCAG00000002737
LinkDB
Position
C2:complement(153837558..153838714)
AA seq 355 aa
MDYTLEPNVTTVTDDYYPDISSSPCDGELIQRDNKLLLAILYCVLFVFSLLGNSLVILVL
VACKRLRSITDIYLLNLALSDLLFVFSFPFQTHYQLDQWVFGTAMCKLVSGFYYIGFFSS
MFFITLMSVDRYLAVVHAVYAMTVRTARMGTALSLLMWLIAIVVTSPLLGLYQVASEDGV
LQCYSSYGQQTLKWKIFIYFEINILGLLVPFTILIFCYVSILHQLKSCQNHNKTKAIKLV
LIVVVASLLFWVPFNVVLFLTSLFNMKILDGCVLSQRLIYATHVTETISFTHCCVNPVIY
AFMGEKFKKHLSEIFQKSCGHILLYAGRQIPREGWDRSSSSCQNPLRSSSIDYIL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggattacaccttggagcccaacgtgacaacagtaactgatgactactatcctgatatc
tcgtcgagcccctgcgacggggaacttatccaaagagataacaagttgttacttgccatc
ctctactgtgtcttgtttgtattcagtcttctggggaacagcctggtcatcctggtcctc
gtcgcctgcaagaggctgaggagcatcacagacatatacctcttgaacctggccctgtcg
gacctgctttttgtcttctccttccccttccagacccactatcagctggaccagtgggtg
tttgggaccgcaatgtgcaagctggtctccggtttttattacatcggcttcttcagcagc
atgttcttcatcaccctcatgagtgtggacaggtacctggcagttgtccacgctgtgtat
gccatgaccgtgaggacggccagaatgggcacagccctgagtctgctcatgtggctgatc
gccatcgtggtcaccagcccgctactgggattgtaccaagtggcctccgaagacggcgtt
ctacagtgctactcgtcttacggtcagcagactctgaagtggaagatcttcatctacttt
gagattaacatcttaggtctgctggtcccattcaccatccttatcttctgctacgtgagc
atcctgcaccaactgaagagctgccaaaaccacaacaagaccaaggccatcaagctggtg
ctcattgtcgtggtcgcttctttgctcttctgggtcccgttcaatgtggtcctcttcctc
acgtccctgttcaacatgaagatcctggacgggtgtgtcctgagccagcggctcatttat
gccacccatgtcacagaaaccatctccttcactcactgctgcgtgaaccctgtgatctac
gcgttcatgggcgagaagttcaagaaacacctctcggaaatattccagaagagctgcggc
cacatcctcctctacgcgggaagacaaatccccagggagggctgggacaggtcctcctcc
tcttgccagaaccccctccgatcctccagcatagactacattttgtga

DBGET integrated database retrieval system