KEGG   Felis catus (domestic cat): 101099760
Entry
101099760         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 13
  KO
K16595  C-C motif chemokine 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101099760
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099760
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099760
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101099760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101099760
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101099760
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101099760
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101099760
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101099760
NCBI-ProteinID: XP_003996618
Ensembl: ENSFCAG00000026454
UniProt: M3X6S8
LinkDB
Position
E1:22145112..22146597
AA seq 98 aa
MRVSAALLCLLLAAAAFSLQALAQPGAFSALFPCCFTFNNKKIPLPKLTTYRITSSHCPQ
TAVIFRTKLAKEICADPKEKWVQEYVKQLSQKSRALKP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagggtctccgcagcgcttctgtgcctgctgctggcagctgccgccttcagcctccag
gcgctcgcccagccaggtgcattcagtgccctgttcccttgctgtttcacatttaacaat
aagaagatccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag
acagctgtcatcttcaggacgaagctggccaaggagatctgtgctgacccgaaggagaaa
tgggtccaggagtatgtgaaacagctcagtcaaaaatctcgtgccctgaagccttga

DBGET integrated database retrieval system