KEGG   Felis catus (domestic cat): 101099898
Entry
101099898         CDS       T02385                                 
Symbol
CX3CR1
Name
(RefSeq) CX3C chemokine receptor 1 isoform X2
  KO
K04192  CX3C chemokine receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099898 (CX3CR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099898 (CX3CR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101099898 (CX3CR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101099898 (CX3CR1)
   04050 Cytokine receptors [BR:fca04050]
    101099898 (CX3CR1)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CX3C Chemokine
    101099898 (CX3CR1)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CX3C Chemokine
   101099898 (CX3CR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 101099898
NCBI-ProteinID: XP_003992272
Ensembl: ENSFCAG00000002736
LinkDB
Position
C2:153917669..153933385
AA seq 356 aa
MPTHSPKSTLEYFEYDESAEACDMGDVVAFGTVFLSILYSLVFAFGLVGNLLVVFALTNS
RKPKSITDIYLLNLALSDLLFVATLPFWTHYLMSEQGLHNAVCKLSTAFFFIGFFGGIFF
ITIISIDRYRAIVLAANSMNTRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDY
PEVLQDLWPVLRNVEANLLGFLLPLLVMSYCYFRIMRTLFSCKNHKKAKAIKLIFLVVVV
FFLFWTPYNIMIFLETLNLYDFFPNCDMKKDLRLALSVTETIAFTHCCLNPFIYAFAGEK
FRRYLYHLYRKCRAVLCGRPVHVGFSPSESQTSKRESILSSDFTHHTSDGDASILL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgcctacccactcccccaaatcaactttggaatactttgagtacgatgagtcggccgaa
gcctgtgatatgggggacgttgtggccttcgggaccgtcttcctgtccatactttactcc
cttgtttttgcctttggcctggtgggaaatttgctggtggtgtttgccctcaccaacagc
cggaagcccaagagtatcaccgacatctacctcctgaacctggccttgtcggatctgctc
tttgtagccacgttgcctttctggactcactacctgatgagcgagcaaggccttcacaac
gccgtgtgcaaactgtctaccgccttcttcttcatcggcttttttggaggcatattcttc
atcaccatcatcagcatcgacaggtaccgggccatcgtcctggccgccaactccatgaac
acccggaccgtgcagcatggcgtcaccatcagcctgggcgtctgggcggcagccatcttg
gtggcagcacctcagttcatgttcacaaaacaaaaagaaaacgagtgccttggtgactac
cctgaggtcctgcaggacctctggcccgttctccgcaacgtggaggcaaatttgcttggt
ttcctgctccccctgctcgttatgagctactgttacttcagaatcatgcggacactgttt
tcctgcaagaaccacaagaaagccaaagccattaagctgatcttcctggtggtcgtcgtg
ttttttctcttctggacaccctacaacatcatgatttttttagagacgcttaatctctat
gacttctttcccaattgtgacatgaagaaggatctgaggttggccctcagtgtgactgag
acgattgcattcacccactgttgcctcaacccctttatctatgcgtttgctggagagaag
ttcagaagatacctttaccacctgtataggaaatgccgggccgtcctgtgtggtcgtcct
gtccacgtcggtttctccccatctgaatcacaaacgagcaagcgggaaagcattctgagc
agtgattttactcaccacaccagtgatggagatgcgtccatccttctctga

DBGET integrated database retrieval system