KEGG   Felis catus (domestic cat): 101100146
Entry
101100146         CDS       T02385                                 
Symbol
IHH
Name
(RefSeq) indian hedgehog protein
  KO
K11989  indian hedgehog
Organism
fca  Felis catus (domestic cat)
Pathway
fca04340  Hedgehog signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101100146 (IHH)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101100146 (IHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101100146 (IHH)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C46: hedgehog family
   101100146 (IHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 101100146
NCBI-ProteinID: XP_019694701
LinkDB
Position
C1:complement(204057571..204063990)
AA seq 410 aa
MSPARLRPRLRFCLLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTL
GASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQ
WPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYE
SKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGNPTFS
DVLIFLDREPDRLRAFRVIETQDPPRRLALTPAHLLFTANNHTEPAAHFRATFASQVQPG
QYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVASCFAAVADHRLAQLAF
WPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHSLGMAGPGS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtctcccgcccggctccggccccgactgcggttctgcctgctcctgctgctgctgctg
gtgccggcggcgcggggctgcgggccgggccgggtggtgggcagccggaggcggccgccg
cgcaagctcgtgccgctcgcctacaagcagttcagccccaacgtgccggagaagacgctg
ggcgccagcgggcgctatgaaggcaagatcgcgcgcagctcggagcgcttcaaggagctc
acccccaactacaatcccgacatcatcttcaaggacgaggagaacacgggcgccgaccgc
ctcatgacccagcgctgcaaggaccgcctgaactcgctggccatctccgtgatgaaccag
tggcccggcgtgaagctgagggtgactgaaggctgggatgaggacggtcaccactctgag
gagtcgctgcactatgagggccgcgcggtggacattaccacttcggaccgcgaccgcaat
aagtacggactgctggcgcgcttggcagtggaggccggcttcgactgggtgtattatgag
tccaaggcccacgtgcactgctccgtcaagtccgagcactctgctgcggccaagacaggt
ggctgctttcctgctggagcccaggtgcgcctagagagcggggcacgtgtggccttgtca
gctgtgagacccggagaccgggtgctggccatgggggaggatgggaaccccaccttcagt
gacgtgctcattttcctggatcgcgagccagacaggctgagggccttccgggtcatcgag
acccaggaccccccgcgccgcctggcactcacgcccgcccacctgctcttcaccgccaat
aatcacacagaaccagcggcccacttccgggccacatttgccagccaagtgcagcctggc
cagtacgtgctggtggccggggtgccgggcctgcaacctgcccgagtggcagccgtctcc
acacacgtggccctgggggcctatgccccactaacaaggcatgggacgctggtagtggag
gatgtggtggcctcctgcttcgcggccgtggctgaccaccgtctggctcagttggccttc
tggcccctgcgactgtttcacagcttggcgtggggcagctggaccccgggggagggtgtg
cactggtacccccagctgctctaccgcctggggcggctcttgttggaagagggcagcttc
cactcactgggcatggctgggccagggagctga

KEGG   Felis catus (domestic cat): 111557492
Entry
111557492         CDS       T02385                                 
Symbol
SHH
Name
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
fca  Felis catus (domestic cat)
Pathway
fca04340  Hedgehog signaling pathway
fca04360  Axon guidance
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    111557492 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    111557492 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111557492 (SHH)
   05205 Proteoglycans in cancer
    111557492 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    111557492 (SHH)
   05217 Basal cell carcinoma
    111557492 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    111557492 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    111557492 (SHH)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C46: hedgehog family
   111557492 (SHH)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Morphogens
   111557492 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 111557492
NCBI-ProteinID: XP_023098125
LinkDB
Position
A2:complement(168807634..168830008)
AA seq 755 aa
MDSYDGSVMSLDKANSGLPPPDTAALAHRWPSPPVLGEREARGQREVSVGFIPASSLTAE
SECHVIARACHVQIASESIDGRVSERDGPTSLSVVAFRELKDPKTALGPRTARQRWDRNH
QARAGVSPHGSLAPSRPSRGRAARAFGGRVASSPAAAAGLRTGEACARRRLDSSPGPGSW
GRRRPTCRDRHQGQPVSQALQACYHLKSDSFCLLIAVSSPNSDVFRYQRPAACRSSPRLG
GDRWPVSRSRGGQGYIGRERQAESEGARSKPERTGTHSRTQTRTGTAGRRWAPDEMLLAR
CMLAVFVSALLMCSGLGCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKI
SRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTE
GWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVK
AENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLTFLDRDD
GAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGEPEAPSGAGPPPGGAPGRRALFA
SRVRPGQRVYVVAERGGDRRLLPAAVHSVTLREEATGAYAPLTAQGTILINRVLASCYAV
IEEHGWAHRAFAPFRLAHALLAVLAPARTDRGGDGDGGGGGHLPPPAPAAPEAPAAADAP
GAAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggacagctacgacgggagcgtgatgtcattggacaaggcaaactctgggctcccaccc
ccagacacagccgccctggctcaccgctggccatcgccacccgtcctgggggaacgagag
gccagaggccagcgggaagtatccgtaggctttatacccgcttcttcgctaacggctgag
tcagaatgccacgtgatcgcacgggcgtgccatgttcagatcgcttccgagtccatcgac
gggcgcgtctcggagagggacggccctaccagcctttctgtggtggcatttcgagaactg
aaggaccccaagacggctctgggcccgcggacggcgcgccagcgctgggatcggaaccac
caggcccgggcaggcgtcagcccacacgggagcctggccccgagccggccctcgcgcggg
cgggcagcgcgggccttcggtggccgggtggcctcctccccggccgcggccgctggcctg
cgcacaggagaagcttgtgctcgtcggcgtctggactccagtcccgggccaggaagctgg
ggacgcagacgccccacgtgcagggatcggcaccaagggcagcctgtctcgcaagctctc
caggcttgctaccatttaaaatcagactctttttgtcttttgattgctgtctctagcccc
aactccgatgtgttccgttatcagcgaccagcagcctgccgctccagcccccgtctgggt
ggggatcggtggccagtctcccgcagccgcggcgggcaaggttatataggaagagaaagg
caggcagagagcgagggagccaggagcaagccggagcgcacgggcacacactcgcgcaca
cagacccgcacggggacagcgggaaggcgctgggctccggacgagatgctgctggcgaga
tgcatgctggcggtgttcgtctccgcactgctgatgtgctcggggctggggtgcggaccc
ggcaggggatttgggaagaggcggcaccccaaaaagctgacccctttagcctacaagcag
ttcatccccaacgtggccgagaagaccctaggggccagcggacgatacgaagggaagatc
tcgagaaactcggagcgattcaaggaactcacccccaattacaaccccgacatcatcttt
aaggatgaagaaaatacgggagcagaccgcctgatgactcagcgctgtaaggacaaactg
aacgcgttggccatctcggtgatgaaccagtggcccggagtgaaactgcgggtgaccgag
ggctgggacgaagacggccaccactcggaggagtcgctgcactatgagggccgcgcggtg
gacatcaccacgtcagaccgagaccgcagcaagtacggcatgctggcgcgcctggccgtc
gaggccggcttcgactgggtttactatgagtccaaggcgcacatccactgctccgtgaaa
gcagagaattcggtggcggccaaatccggcggctgcttcccgggctcggccacggtgcac
ctggagcagggcggcaccaagctggtgaaagacctgcgtcccggggaccgcgtgctggcg
gccgacgaccagggccgactgctctacagcgacttcctcaccttcctggaccgcgacgac
ggcgccaagaaggtcttctacgtgatcgagacgcgggagccgcgcgagcgcctgctgctc
accgccgcgcacctgctcttcgtggcgccgcacaacgactcggcggccggggagccggag
gcgccgtcgggcgcggggccgccgccggggggcgcgccggggcgccgggcgctcttcgcc
agccgcgtgcgcccgggccagcgcgtgtacgtggtggccgagcgcggcggggaccgccgg
ctgcttccggccgccgtgcacagcgtgacgctgcgcgaggaggccacgggcgcgtacgcg
ccgctcacggcgcagggcaccatcctcatcaaccgggtgctggcgtcgtgctacgcggtc
atcgaggagcacggctgggcccatcgggccttcgcgcccttccgcctggcgcacgcgctc
ctggccgtgctggcgcccgcgcgcacggaccgcggcggggacggcgacggcgggggcggc
ggccacctgcccccgcccgcgccggctgcgcccgaggcgccggctgcggccgacgcgccg
ggtgccgcgggcatccactggtactcgcagctgctctaccaaataggcacctggctgttg
gacagcgaggccctgcacccgctgggcatggcggtcaagtctagctga

DBGET integrated database retrieval system